KEGG   Anoxybacillus flavithermus: Aflv_1105Help
Entry
Aflv_1105         CDS       T00790                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aflv_1105 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aflv_1105 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aflv_1105 (trpB)
Enzymes [BR:afl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aflv_1105 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1095234..1096430
Genome map
AA seq 398 aa AA seqDB search
MLTLPNERGRFGMFGGKFVPETLMRPLADIERQLYEALADPSFHAEYMHHLYEYSGRPTA
LTFAKNLTERLGGAKMYFKREDLNHTGAHKINNAIGQALLAKRMGKRKIIAETGAGQHGV
AAATVAARFGMECKVFMGEEDVKRQSLNVFRMKLLGAEVIPVTSGNRTLKDATNEAIRYW
VEHCDDHFYMIGSVVGPHPYPMMVREFQRIIGEEAREQMLKAEGKLPNTIIACVGGGSNA
IGMFHPFLDDDVECIGVEAAGKGVHTTEHAATITKGTKGVIHGSLTYVLQDEHGQIVEPY
SISAGLDYPGVGPEHAYLAHIGRVRYESVTDEEAIAALQMTAETEGIIPAIESAHALAKA
FQIAPLRSKHETILVCLSGRGDKDVQTVMNYLEGDERK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgacattgccaaatgaacgcggtcgctttggtatgtttggtggaaagtttgtgcca
gaaacattaatgcgtccgttagctgatatagagcgccaattgtatgaagcattggccgat
ccttcgttccatgcggaatatatgcatcatttgtatgaatattcaggtcgtccgaccgcc
ttaacatttgcaaaaaacttgacagaacgattaggcggggcgaaaatgtactttaaacgt
gaagacttaaaccatacaggtgcccataaaataaacaacgcgatcgggcaagcgttgtta
gcaaaacgaatgggaaaacgaaaaattatcgctgaaacaggtgcaggacagcacggcgta
gccgcagcgaccgtcgccgctcgttttgggatggaatgcaaagtatttatgggtgaggaa
gatgtgaaacggcagtcattaaacgtatttcgtatgaaactgcttggtgcagaagtcatt
ccagtcacaagcggcaatcgtacattaaaagacgcaacaaatgaagcgattcgttattgg
gtggagcattgtgacgaccatttttacatgattggttccgtcgttggcccgcatccatat
ccgatgatggtgcgtgaatttcaacgtattatcggcgaagaagcgcgcgaacaaatgtta
aaagcagaaggaaaactgccgaacacaatcattgcttgtgttggtggcggaagtaatgcg
atcggaatgttccatccatttttagatgatgatgttgaatgtattggtgttgaggcagct
ggaaaaggtgtgcatacgacggagcatgctgcaacgataacaaaaggaacaaaaggtgtc
attcatggttccctcacatacgtattgcaagatgagcacggtcaaattgtggagccgtat
tcgatttcagctggtttagattatccaggtgttggaccagagcatgcatatttagcacat
attggacgcgttcgctatgagagtgtaacggacgaggaagcgattgcagcacttcaaatg
actgcagaaacagagggaatcattccagcaatcgaatctgcgcatgcgctcgccaaagcg
tttcaaatcgccccccttcgttcaaaacatgaaacgattctcgtttgtttatcaggaaga
ggcgataaagatgtacaaacggtgatgaactatttggaaggggatgaacggaaatga

DBGET integrated database retrieval system