KEGG   Anoxybacillus flavithermus: Aflv_1106Help
Entry
Aflv_1106         CDS       T00790                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afl  Anoxybacillus flavithermus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aflv_1106 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aflv_1106 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aflv_1106 (trpA)
Enzymes [BR:afl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aflv_1106 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1096427..1097266
Genome map
AA seq 279 aa AA seqDB search
MKHFIPFIVAGDPCEEVTIDLAIALEQAGATILELGVPYSDPLADGPIIQRAASRALKNG
MTLTRALELIGRMRKKGVKIPIIVFTYYNPVLQLGEERFFALAQQNGASGVLIPDLPFEE
SEHMRTLGDTYDIPYISLVAPTSHERIAMIASQAQSFLYCVSSLGVTGIRDSLPKQLHEF
LQQVKSYSRVPIVVGFGISTAEQVERLQHICDGVVIGSAIVKKIEQLQDELNDAHTRSNA
LIAFSQYVASLIEPLKRVRKNESETTTETTKTVSTGQTD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattccatttatcgtggcgggcgatccgtgtgaagaggtgacgatcgat
ttagctattgctcttgaacaggcaggtgcaacgatattagaactcggtgtaccatactcc
gatccgcttgcagatgggccgattattcaacgggcagcgagtcgagctctaaaaaatgga
atgactttaacaagagcgcttgaactcatcgggcgaatgagaaaaaaaggtgtaaaaatt
ccgattattgtctttacgtattacaatcctgtgttacaattaggagaagaacgctttttc
gctttagcgcaacaaaatggtgcgagcggcgtactcattccagatttaccgtttgaagaa
agcgagcatatgagaacattaggcgacacatatgacattccttatatttcacttgtcgct
ccaacgtctcatgagcgcatcgcgatgattgcatcgcaagcccaatcgtttttatattgc
gtgtcatcattaggtgtgacgggcattcgggactcgttgccgaagcaattgcacgaattt
ttgcaacaagtaaaatcatatagccgtgttcctatcgtcgttggatttggtatttctacg
gctgaacaagtcgagcgacttcaacatatatgtgatggtgtcgttatcggtagcgccatc
gtaaaaaagattgaacagcttcaagacgaattgaacgatgcgcatacgcgctcaaatgcg
cttatcgctttttcccaatatgtcgcttcgctcattgaaccattgaaaagggtgaggaaa
aatgaaagtgaaacaacaactgaaacaactaaaaccgtatcaaccgggcaaaccgattga

DBGET integrated database retrieval system