KEGG   Anoxybacillus flavithermus: Aflv_1570Help
Entry
Aflv_1570         CDS       T00790                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
afl  Anoxybacillus flavithermus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aflv_1570
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aflv_1570
   00630 Glyoxylate and dicarboxylate metabolism
    Aflv_1570
Enzymes [BR:afl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Aflv_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572120..1574306)
Genome map
AA seq 728 aa AA seqDB search
MMGEYVQVGRLQVAKLFYEFIVGEVLPNSQVDKDKFWKNFEQLINEFTPKNKALLAKRDE
LQEKINEWHKQHRSQFNFEQYKSFLREIGYLEPEVEDFEITTEHVDDEIAKQAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDVISEEDGAERGKGYNPVRGEKVIAYVREFLDETV
PLRGYSHKDAVQYAVVNGTLTVTVKDGQTTTLQHEKKFVGYQGSPTQPSAILLKNNGLHI
EIQIDRTHPIGQTDPAGIKDVYLESALTTIMDCEDSVAAVDAEDKVLVYRNLLGLVRGDL
TASFTKGNKTVTRELNPDRVYTTPSGETLNLPGRSLMFVRNVGHLMTNNTILLENGEEVY
EGILDAVVTTLIMKHSLLGNGKYVNSRKGSIYIVKPKMHGSEEVAFANELFDRVEDMLGL
ERNTIKIGVMDEERRTTLNLKNCIYQVRDRIVFINTGFLDRTGDEIHTSMEAGPMIRKNE
MKSSTWLQSYEKSNVSVGLATGFQGRAQIGKGMWAMPDMMAEMLKQKIAHPQAGANTAWV
PSPTAATLHALHYHKVDVFVVQDELRKHIKNYCDDILQIPVAINPQWTPEDIQQELDNNA
QGILGYVVRWIDQGIGCSKVPDIHNIGLMEDRATLRISSQHIANWLHHGICTKEQVLETL
KRMAKVVDEQNADDPAYRPMSVDYDNSVAFQAACDLVFKGYEQPNGYTEPILHRRRLEAK
AKYAHVKQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggaatatgtacaagttgggcgtttgcaagtcgctaagttgttttatgaattt
atcgttggagaagtgttgccaaatagccaagtagataaagataaattttggaaaaacttt
gagcagctcattaatgagttcacaccaaaaaataaagcgttgcttgcgaagcgtgatgag
ttacaagaaaaaataaatgagtggcataaacaacatcgttcgcagttcaattttgaacag
tataaatcgtttttacgggaaatcggctatttagagccggaggttgaggattttgaaatt
acaacggaacatgtcgatgatgaaattgctaaacaagcggggccgcaacttgttgttccg
attacaaacgcacgttacgcgctcaatgcagccaatgcccgttggggaagtttgtacgat
gcgctgtatggaacagatgtcattagtgaagaagatggtgcagagcgcggaaagggatac
aatccggtgcggggtgagaaagtcattgcttatgtgcgtgaatttttagatgaaacggta
ccgcttcgtgggtattcacataaagatgctgtgcaatacgctgtcgtaaatggtacatta
accgtcactgtaaaagatggacaaacgacaacgttacaacatgaaaaaaaatttgtcgga
tatcaaggttcgccaacacaaccatccgctattttattaaaaaacaacggcctacatatt
gaaatacaaattgatcgtactcatccaattggacagacggatccagcaggtattaaggac
gtttatttagagtcagctttaacaacgattatggattgcgaagattccgttgccgcagta
gatgcggaagataaagtgcttgtatatcgcaatttgctcggcttagttcgtggtgactta
acggcgagctttacaaaaggaaacaaaaccgttacgcgcgaattaaatccagatcgtgta
tatacaacgccaagcggcgaaacgctcaacttgccaggacgctcacttatgtttgtacgc
aacgtcggacatttaatgacaaacaatacaattttgcttgaaaacggagaagaagtgtat
gaaggtattttagatgcggttgtgacgacgttaattatgaagcattcgcttcttggtaat
ggaaaatacgtcaattcaagaaaaggttccatttatattgtaaagccaaaaatgcacgga
tcagaagaagtagcatttgcgaacgaattatttgatcgtgtggaagatatgctcggtctt
gaacgcaacacgattaaaattggtgtaatggatgaagaacgacggacaacgttgaattta
aaaaattgtatttatcaagtaagagatcgaattgtttttattaatacaggctttttagac
cgcacaggagatgaaattcatacgtccatggaagcgggtccgatgattcggaaaaacgaa
atgaaatcatcgacatggctgcaaagctatgaaaaatcaaacgttagtgtgggattggcg
acaggctttcaaggacgcgctcaaattggtaaaggcatgtgggcaatgcctgatatgatg
gccgagatgctaaagcaaaaaattgctcatccgcaagcaggagcgaatacagcgtgggtg
ccgtccccaacagcagcgacgttacatgcactccattatcataaggtcgacgtatttgtg
gtgcaagatgagttgagaaaacatatcaaaaattattgtgacgatatattacaaattcct
gtcgctattaatccgcaatggacgccagaagacattcaacaagagctggacaataatgca
caaggtattctcggttacgtcgttcgttggattgatcaagggattggatgttcgaaagta
ccggatattcataacatcggtctcatggaagatcgtgcaacgttgcgcatttcaagtcaa
catattgccaactggttgcatcatggcatttgtacgaaagaacaagtacttgaaacgcta
aagcgaatggcgaaagttgttgatgaacaaaatgcagacgacccagcatatcggccaatg
tcggttgattatgacaattcagttgctttccaagctgcatgcgatcttgtttttaaaggc
tatgagcaaccaaacggctatacggagccaatcttacatcgtcgtcgtttagaagcaaaa
gcaaaatatgcacatgtaaaacaatag

DBGET integrated database retrieval system