KEGG   Anoxybacillus flavithermus: Aflv_1703Help
Entry
Aflv_1703         CDS       T00790                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
afl  Anoxybacillus flavithermus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:afl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700261..1701415)
Genome map
AA seq 384 aa AA seqDB search
MNSLRAISLLGATGSIGMQTLDVIRAHPDAFRLVAFSAGRNIEQARHIIEQFSPNIVCVA
QKEDAERLQSEYKGRVRIAFGEDGLIEVATVQEADIVVNAVVGSVGLVPTLKAIEAKKTI
ALANKETLVTAGHLVMKHAADYGVTILPVDSEHSAIFQCLQGEQQKNIEYIILTASGGSF
RDRTREQLQHVTVEEALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFHLPYEQIDVLL
HKESIIHSMVQFHDGSVIAQLGTPDMRVPIQYALTYPDRFPLHIERLNLAQVATLHFQKV
DMDRFRCLQFAYEAGKIGGTMPTVLNAANEEAVSAFLTGRISFLAIEQYIEQAMNWHVPI
AHPDLETIRTVDRETRQYVKSLYM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagtttgcgagcaattagtttattaggagcgactggctcgatcggcatgcaaacg
ttagatgtcattcgcgctcatcccgatgcgttccgtctcgttgctttttcagccggacga
aacatcgagcaggctcgacatattattgagcaattttcaccaaacatcgtatgcgtggcg
caaaaagaagatgccgaacggttacaaagcgaatataagggacgagtgcgtatcgctttc
ggtgaagatggcctcattgaagtggcgacagttcaagaagcggacattgttgtcaacgca
gttgttgggagcgttgggctagttcctacgttaaaggcgattgaggcgaaaaaaacgatt
gcgttagcgaataaagaaacgttagttaccgcaggtcatcttgtcatgaaacacgctgcc
gattatggcgtaacgattttgccggttgatagtgagcattctgctatttttcaatgtttg
caaggggaacaacaaaaaaatatcgaatatattattttgacggcatctggtgggagtttt
cgcgatcggacgcgcgaacaactacagcatgttacggtggaagaggcgttaaaacatcca
aattggtcgatgggagcgaaaattacaattgattctgcaacgatgatgaacaaaggactc
gaagtgatcgaagcacactggttgttccacttaccgtatgaacaaattgacgtgctgtta
cataaagaaagcattattcattcgatggtgcaatttcacgacggaagtgtcatcgctcaa
ctaggaacgccagatatgcgcgtaccgattcaatatgcattaacataccctgaccgtttt
ccgctacatattgaacggctaaacttagcacaagtagccacgttgcactttcaaaaagtg
gacatggaccgattccgttgtttacaatttgcttatgaagcaggaaaaatcggcggaacg
atgccgaccgtattaaatgcggccaacgaagaagcggtgtcggcctttttaactggacga
atatcgtttttagcgattgaacaatacattgaacaagcaatgaattggcacgtaccgatc
gctcatccggatcttgaaacgattcgtacagttgatcgcgaaacgcgacaatatgtaaaa
tcactatacatgtaa

DBGET integrated database retrieval system