KEGG   Anoxybacillus flavithermus: Aflv_1868Help
Entry
Aflv_1868         CDS       T00790                                 

Gene name
ctaC
Definition
cytochrome caa3 oxidase subunit II
Orthology
K02275  
cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:afl00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1853349..1854413)
Genome map
AA seq 354 aa AA seqDB search
MKKWLRNWRLVSLVSAMALLLAGCGKPFLSTLQPAGEVADMQYKLMLLSTAIMVIVIAVV
TIIFLYVVTRFRRRKGEENKIPKQVEGSHTLEIIWTVIPIILLIILAVPTVLYTFKLADV
KPMNKKERDVVVVNVRANLYWWEFEYPDYGIITSQDLVVPTGERVYFNLKASDVKHSFWI
PAVGGKMDTNTDNTNQFFLTFDDKRAGEAGRLFYGKCAELCGPSHALMDFKVKALPRAEF
DQWVEKMKNAKPVASTDPVVKQGEEIFNKSCIGCHAVTPVDGRPEQARLAPNLGNFADRQ
RIAGVLEHNEENLKAWLKDPEKIKPGNKMTGTYPQLSDQEIDALTKYLMTLSVE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtggctacgaaattggcgcttggtttctctcgtatccgccatggcgcttttg
ctagctggttgcggtaagccgtttttatcgacgcttcagccagcaggggaagtagctgac
atgcagtataagcttatgctgctcagcacggccatcatggtcatcgtcattgcggttgta
acaattatcttcctttacgttgtgactcgcttccgccgtcgtaaaggggaagaaaacaaa
attccaaaacaagtagaaggaagccatacacttgaaattatttggacagttataccgatt
attttgctaatcattttagctgttccgacggttttatacacgtttaaacttgcggatgta
aaaccgatgaacaaaaaagagcgtgacgtcgttgtcgtcaacgttcgcgcgaacttgtac
tggtgggagtttgagtacccagattacggcattattacaagccaagatttagtcgttcca
acaggcgaacgcgtgtatttcaatttaaaagcatctgacgtcaaacactcgttctggatt
ccagctgtcggaggaaaaatggatacaaatacagataacacaaaccaatttttcctcaca
tttgatgacaaacgtgccggagaggcaggtcgtctattttacggaaaatgtgcggagctt
tgcggcccgtcgcatgcgttgatggactttaaagtgaaggcgcttcctcgcgcagagttt
gatcaatgggtagaaaaaatgaaaaatgcgaaacctgttgcatcgacagacccagttgtg
aagcaaggggaagaaattttcaacaaaagctgtattggctgtcacgcggtcacgccggtc
gatggtcgccctgagcaagcgcgccttgcgccaaacttaggaaactttgcggatcgtcaa
cgcattgcaggcgtattggaacataacgaagaaaacttaaaagcttggttaaaagatcca
gagaaaataaaaccaggcaacaaaatgacaggcacatatcctcaattgtctgatcaagaa
attgacgcattaacaaaatacttaatgacattatctgttgagtaa

DBGET integrated database retrieval system