KEGG   Anoxybacillus flavithermus: Aflv_1892Help
Entry
Aflv_1892         CDS       T00790                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00020  Citrate cycle (TCA cycle)
afl00620  Pyruvate metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
Module
afl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_1892 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Aflv_1892 (pdhC)
   00620 Pyruvate metabolism
    Aflv_1892 (pdhC)
Enzymes [BR:afl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aflv_1892 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACJ34253
UniProt: B7GIA9
Position
complement(1874966..1876270)
Genome map
AA seq 434 aa AA seqDB search
MRSMAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVL
EILVSEGTVATVGQTLIKFDAPGYENLKFKGDHGDEPKVEEKKEEVKQEQPAQEQPAQAQ
PKKRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKQDIDAYLAGGAAPQTEAKAPQAET
VAPAQEQKAAPTAQPVVLEGEFPETREKMSGIRRAIAKAMVNSKHTAPHVTLMDEVDVTK
LVAHRKKFKDVAAQKGIKLTFLPYVVKALTSALREYPALNTSIDDATEEIVHKHYYNIGI
AADTDKGLLVPVVKHADRKSIFAIAKEINELATKAREGKLMPNEMKGATCTITNIGSAGG
QWFTPVINHPEVAILGIGRISEKPIVRDGEIVIAPVLALSLSFDHRMIDGATAQNALNHI
KRLLNDPELLLMEA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttgagatccatggcatttgaatttaaattaccggatatcggtgaaggaattcacgaaggt
gaaattgtcaaatggtttgtgaaaccgggcgatgaagtaaacgaagacgacgtactttgc
gaagtgcaaaacgataaagccgttgtcgaaattccatctccagttaaagggaaagtatta
gaaattttagtgagcgaaggaacagttgcgacggtcggtcaaacgttaattaaatttgat
gcaccaggatacgaaaacttaaaatttaaaggcgatcatggcgatgagccaaaagtagaa
gaaaagaaagaagaagtaaaacaagagcaaccagctcaagagcaaccagctcaagcgcaa
ccgaaaaaacgcgtcatcgcgatgccgtctgtgcgcaaatatgcgcgtgaaaaaggtgtc
gacattcgcctcgtgcaaggaacaggcaaaaatggtcgcgtgttaaaacaagatatcgat
gcgtacttagcaggcggtgcagcgccacaaacagaagcaaaagcaccacaagcggaaaca
gttgcgccagcgcaagaacaaaaagcagcgccaacagctcaaccagttgtgctcgaaggc
gagttcccagaaacacgcgagaaaatgagcggcattcgtcgcgcgatcgccaaagcgatg
gtgaactcgaaacataccgcaccacacgttacattaatggacgaagtcgatgtgacaaaa
cttgttgcgcatcgtaagaaatttaaagatgtagcagcgcaaaaaggcattaagttaacg
ttcttaccgtacgtcgttaaagcgttaacgtctgcgcttcgcgaatatccagcgctcaac
acatccatcgatgatgcgacagaagaaatcgttcataaacattactacaacatcggaatt
gcagcggacacagataaaggcttgctcgttccggttgtgaaacatgccgaccgcaaatcg
atttttgcgatcgccaaagaaattaacgagcttgcaacaaaagcgcgcgaaggcaaatta
atgccaaacgaaatgaaaggtgcaacatgcacaattacaaacatcggttcagcaggcggt
caatggtttacaccagtcattaaccatccagaagtagcgattttaggtatcggccgcatt
tcagaaaaaccgatcgtgcgcgatggtgaaattgtgatcgctccagtcttagcgttgtcg
ttaagcttcgaccaccgcatgatcgacggtgcaactgcacaaaatgcgttaaatcacata
aaacgtttattaaacgatcctgaattattattaatggaggcgtaa

DBGET integrated database retrieval system