KEGG   Anoxybacillus flavithermus: Aflv_2499Help
Entry
Aflv_2499         CDS       T00790                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
afl  Anoxybacillus flavithermus
Brite
Enzymes [BR:afl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Aflv_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2471005..2471745)
Genome map
AA seq 246 aa AA seqDB search
MMKMIPPQPFTFEAGERAVLLLHGFTGNSADVRMLGRFLQSKGYTCHAPIYKGHGVPPEE
LVHTGPEDWWQDVINAYEYLKQTHEKIAVVGLSLGGVFSLKLGYTVPVVGIVPMCAPMYI
KSEQTMYEGVLAYAREYKKREGKSEEQIEREMAEFAKTPMKTLKALQQLIADVRDHLDFI
YAPVFVVQARHDDMINPDSANIIYNGVESPVKQIKWYEESGHVITLDKEKEQLHEDIYAF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagatgattcccccacaaccgtttacgtttgaagctggtgaacgtgctgtttta
ttattgcatggatttactggaaattcggcggatgttcgtatgcttggtcgtttcttacaa
tcaaaaggatatacgtgccacgctccaatttataaaggacatggcgtgccgccagaggag
ctcgttcataccggcccggaagattggtggcaagatgtgataaacgcttacgaatattta
aaacaaacccatgaaaaaatcgctgttgttggattatcgcttggcggtgtgttttcgtta
aaacttggctatactgttcctgtcgttggcatcgtaccaatgtgtgccccgatgtatatt
aaaagcgaacagacgatgtatgaaggagttttagcatacgctcgcgaatataaaaagcga
gaaggaaaaagcgaggagcaaatcgagcgcgaaatggcggagtttgcgaaaacgccgatg
aaaacgctaaaagcgttgcaacaactcattgctgatgtgcgcgatcatttagatttcatt
tatgcgcctgtttttgttgtacaagcgcgtcatgatgacatgattaacccagatagtgca
aatattatttataacggcgtcgagtctcccgtaaaacaaatcaaatggtatgaggagtca
ggacacgtcattacgcttgataaagaaaaagaacagcttcatgaagacatttatgcattt
ttagaatcattagattggtaa

DBGET integrated database retrieval system