KEGG   Anoxybacillus flavithermus: Aflv_2674Help
Entry
Aflv_2674         CDS       T00790                                 

Gene name
gtaB
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00040  Pentose and glucuronate interconversions
afl00052  Galactose metabolism
afl00500  Starch and sucrose metabolism
afl00520  Amino sugar and nucleotide sugar metabolism
afl01100  Metabolic pathways
afl01130  Biosynthesis of antibiotics
Module
afl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Aflv_2674 (gtaB)
   00052 Galactose metabolism
    Aflv_2674 (gtaB)
   00500 Starch and sucrose metabolism
    Aflv_2674 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    Aflv_2674 (gtaB)
Enzymes [BR:afl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Aflv_2674 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Smr PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: ACJ35027
UniProt: B7GMC5
Position
complement(2668526..2669497)
Genome map
AA seq 323 aa AA seqDB search
MYIDACIMHNMYVEVYFRGRGICVKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPT
IQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHAFELEQTLLKNNKHDLLEKVKEPSKVD
IYYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIVQAETPCLKQLMNEFEQTRSSVIG
VKQVADDKTHRYGIIDPIDKKGRRYQVKQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLE
KQETGAGGEIQLTDAIQKLNEIQRVFAYEFEGKRYDVGEKLGFIQTTIEFGLQNEEIKDE
LLKFMREIVCNGALSRSDVCRDL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttgtacatcgatgcatgtattatgcataatatgtacgtggaggtatattttagagggaga
gggatatgtgtgaaaaaggtgcggaaggcaatcatcccagctgcagggcttggaacaaga
tttttacctgcgacaaaagcgatgccaaaagaaatgcttccgatcgtcgacaaaccgacg
attcaatatatcgttgaagaggcgatcgaatcaggcattgaagacattattatcgtcaca
ggaaaaggaaagcgtgccatcgaagaccatttcgatcatgcgtttgaacttgaacaaacg
ttgttaaaaaacaataaacatgacctactagagaaagtaaaagagccatccaaagtcgac
atttattacattcgccaaaaagaaccgaaaggactaggacatgccgtctggtgcgcgcgc
aaatttatcggagacgaaccgtttgctgtcctattaggtgacgatattgtccaagccgaa
acgccatgtttaaaacaactgatgaatgaatttgaacaaacgagaagctccgtcattggt
gtcaaacaagtcgctgacgacaaaacgcaccgctacggcatcatcgacccaatcgacaaa
aaaggacgtcgctaccaagtgaaacaattcgtcgaaaaaccagcaccaggcaccgcgcca
tcgaacttggcgattatgggccgatacatactcacgccagaaatttttctattcctcgaa
aaacaagaaacaggtgccggcggagaaatccaactgaccgatgcgattcaaaaactgaat
gagattcaaagggtgtttgcctacgagttcgaaggcaagcggtatgacgttggggagaag
ctaggatttatccagacgacgattgagtttggcttgcaaaatgaagagattaaagatgaa
ctgttaaaattcatgagggaaatcgtttgtaacggtgcactgtcacgctccgatgtatgt
cgagatttgtag

DBGET integrated database retrieval system