KEGG   Anoxybacillus flavithermus: Aflv_2814Help
Entry
Aflv_2814         CDS       T00790                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase domain and Fe-dependent alcohol dehydrogense domain
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00010  Glycolysis / Gluconeogenesis
afl00071  Fatty acid degradation
afl00350  Tyrosine metabolism
afl00620  Pyruvate metabolism
afl00625  Chloroalkane and chloroalkene degradation
afl00626  Naphthalene degradation
afl00650  Butanoate metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aflv_2814
   00620 Pyruvate metabolism
    Aflv_2814
   00650 Butanoate metabolism
    Aflv_2814
  Lipid metabolism
   00071 Fatty acid degradation
    Aflv_2814
  Amino acid metabolism
   00350 Tyrosine metabolism
    Aflv_2814
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aflv_2814
   00626 Naphthalene degradation
    Aflv_2814
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Aflv_2814
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Aflv_2814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACJ35167
UniProt: B7GMR5
Position
complement(2795811..2798453)
Genome map
AA seq 880 aa AA seqDB search
MNIFTRTILGGSYMAVDEKVLDQKKEVTKMIDTLVANAQKALKAFHDYDQETIDHIVKQM
ALAGLDKHMYLAKLAIEETKRGVYEDKIIKNIFATEYIYHNIKYDKTVGVIRENEQEGII
EIAEPVGVIAGVTPVTNPTSTTMFKALISIKTRNPIIFAFHPSAQKCSSEAARILRDAAI
AAGAPEHCIQWIETPSVEATQQLMHHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVP
CYIEKTANIKRAVNDLILSKTFDNGMICASEQAVIIDKEIYDAVKNEMIANKCYFLNEEE
KKKVEKLVINENTCAVNPNIVGKPAYEIAKMAGIDVPVDTKILVAELKSVGPQEPLSREK
LSPVLACYKVNSTEEGLKRAEEMLEFGGLGHSAVIHSENQEVILEFGKRMKAGRIISNAP
SSQGAIGDIYNAYIPSLTLGCGTFGGNSVSTNVGATHLINIKKLARRNVNMQWFKVPPKI
YFEKHATQYLAKMPNISRAFIVTDPGMVTLGYVDKVLYYLRKRPDYVHCEIFSEVEPDPS
IETVMKGADMMHAFQPDVIIALGGGSAMDAAKAMWLFYEHPNTDFNGLKQKFLDIRKRVF
KYPKLGQKAQFVAIPTTSGTGSEVTSFAVITDKKNNVKYPLADYELTPDVAIVDPQFVMT
MPKHITADTGMDVLTHAIEAYVSNMANDYTDGLALKAIQLVFEYLPRAYKNGNDEVAREK
MHNASTIAGMAFANAFLGINHSLAHKLGAEFHIPHGRANTILMPHVIRYNAQKPKKFTAF
PKYEHFVADERYAQIARLLGLPARTTEEGVESLVQAIIKLAKELDMPLSIAATGVSKEAF
ESKVDQLAELAFEDQCTTANPKLPLVSDLADIYRQAYKGV
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattttcacaagaacaatattaggagggtcttatatggctgtcgatgaaaaagta
ttagaccaaaagaaagaagttacgaaaatgattgatacgcttgtagccaatgcgcaaaaa
gcgttaaaagcgtttcatgactatgatcaagagacgatcgatcatatcgtcaagcaaatg
gcgttagctgggcttgataaacatatgtatttagcgaagttagcgatcgaagaaacaaaa
cgcggtgtatatgaagataaaatcattaaaaatatttttgcgacagaatatatttaccat
aacattaaatacgataaaacagttggcgtcattcgcgaaaatgaacaagaaggcataatt
gaaattgctgagcctgttggcgtcatcgctggagttacaccagtaacaaacccaacatca
acaacgatgtttaaagcactaatttcaattaaaacgcgcaacccaatcatttttgcgttc
cacccatctgcgcaaaaatgtagcagtgaagcagcacgtattttgcgcgatgcagccatt
gcagctggcgcgccagaacattgtattcaatggatcgaaactccttctgtcgaagcgact
caacaattgatgcaccatcctggcgtttcgcttattcttgcgacaggtggagcaggcatg
gtgaaggcggcatatagctcaggaaaaccagcattaggggttggacctggtaacgtacct
tgttatattgaaaaaacagcaaacattaaacgtgcggtgaacgatctcattttgtctaaa
acgtttgataacgggatgatttgtgcatcggagcaagcggtcattattgataaagagatt
tatgatgcggtgaaaaacgaaatgatcgcaaataagtgctatttcttaaatgaagaagaa
aagaaaaaagttgaaaagcttgtcatcaatgaaaatacgtgtgcagtcaatccgaatatc
gtcggtaaaccagcgtatgaaattgcaaaaatggcaggcatcgatgtaccagttgataca
aaaattctcgtagccgagttaaaaagcgtcggtcctcaagaaccgctttctcgtgaaaaa
ttaagtccggtattggcttgttataaggtgaatagcacagaagaaggattaaaacgagca
gaagaaatgcttgaattcggtggacttggccattcggctgtcattcattcagaaaatcaa
gaagtcattcttgaattcggtaagcgaatgaaggcagggcgaattatttcgaacgcacca
tcttcacaaggagcgatcggagacatttataacgcgtacattccgtcgttgacgctcggt
tgcggtacgtttggaggcaactccgtttcgacaaacgttggtgcgacacatttaattaac
attaaaaaattagcgagaaggaatgtaaacatgcagtggtttaaagttccaccaaaaatt
tattttgaaaaacatgcgacacaatatttagcgaaaatgccaaacatctcacgtgccttt
atcgttacagacccaggtatggtgacgctcggctatgtcgataaagtgttatactatttg
cgtaaacgtccagattatgtgcattgcgaaattttctcagaagtggaaccagatccatca
attgaaacagtgatgaaaggtgcggacatgatgcatgcgttccaaccagacgtcatcatc
gccctcggcggtggttcggcgatggacgcggcgaaagcgatgtggttgttctatgaacat
ccgaatacagactttaacggtttaaaacaaaagtttttagatattcgtaaacgcgtcttt
aaatatccaaaactcggtcaaaaagcgcaatttgtcgcgattccaacaacatctggtaca
ggttcagaagtgacatcgtttgcggtcattacagataagaaaaataacgtcaaatatccg
cttgctgactacgagttaacaccagatgtcgccatcgttgacccacaattcgtcatgacg
atgccaaaacatattacagcggatacaggtatggacgtattaacacatgcgattgaagca
tacgtatcgaacatggcaaacgactatacagacggattagcgttaaaagcgattcaactc
gtctttgaatacttgccacgcgcatataaaaacggcaacgatgaagtagcacgtgaaaaa
atgcataacgcatcaacgatcgctggtatggcatttgccaacgcattcttaggcattaac
catagtttagcgcataaacttggggcagaattccatattccgcacggacgtgcaaatacg
attttaatgccgcatgtcattcgttacaacgcgcaaaaaccgaagaaatttacagcgttt
ccgaagtacgaacatttcgtagctgacgaacgttatgctcaaattgcgcgcttgctcggc
ttgccagcaagaacgacagaagaaggagtagaaagcctcgttcaagcgatcattaagctt
gcaaaagaacttgatatgccattaagcatcgcggcaacaggcgtcagcaaagaagcattc
gaaagcaaagttgaccaactcgctgaattagctttcgaagatcaatgtacaacagctaat
ccaaaattgccattagtcagcgaccttgccgacatttatcgccaagcgtataagggagtg
taa

DBGET integrated database retrieval system