KEGG   Aspergillus fumigatus: AFUA_1G00640Help
Entry
AFUA_1G00640      CDS       T01017                                 

Definition
choline kinase (EC:2.7.1.32)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
afm  Aspergillus fumigatus
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:afm00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 369 aa AA seqDB search
MATAISVPVTFPEDKVPTTKDVRDIIGAFLTEEWPPVESETLTVSYHASFVNAHRPVERP
KPDTATSTEPLKVFIKLHNDTSGGLEIFEPLVPTKHEEALFCYEYGQTELGAEVYGFFKT
QDGTLGRVEEFLDARNMELEDVEDSAIRADVAKGLAIFHAEMLKALGKEGGAMIDNLVSY
DFGKRLRSVVDKLASVVRKTRWCIHDVQFMNVMVKNDPREGESKVVLIDFEFVMQNYRAF
DIGGHFMQKMFKWFDEESKIAKCRKYTEKEKKHFCDEYARQWNQLTGDSDTGDQVFEESE
YGYLLAITFNIHNMLCFMYEQGDKDPLNLHRKKKGGHALSSISLSSYASSYVWSTGEYSA
RSFSVFGCE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcgatctccgttcctgtcacttttcccgaagacaaagtaccgactaccaag
gatgtcagggacattatcggcgcatttctgacggaggaatggccacctgtggagtcagag
accctgactgtgtcataccatgcatcttttgttaacgctcaccgccccgtggagcgaccg
aagcccgatactgccacatctactgagcccttgaaggtgttcattaaactccataatgac
accagtggtgggctcgaaatcttcgagcctctggtgccaaccaagcatgaggaagcactt
ttctgttacgagtacggtcaaactgaactgggggccgaagtctacggattcttcaagaca
caggatggcacactcgggagagtcgaagagttcctggatgcacgcaacatggaactggag
gatgttgaggattcggccatccgagcagatgttgctaaagggctggcgatatttcatgcg
gaaatgttgaaggcactcggcaaggaaggaggagcgatgatcgacaacctagttagctac
gactttgggaagaggctgagaagtgtggtggacaagctggcatctgttgtgcgaaagacc
agatggtgtatacatgatgtccaattcatgaacgtgatggtgaagaatgacccgagggaa
ggggagagcaaagtcgtcctgattgactttgagtttgtgatgcagaactatcgtgcattt
gacatcggtgggcacttcatgcaaaagatgttcaagtggtttgatgaggagagcaagatc
gccaaatgcagaaaatatacagagaaggaaaagaaacacttctgtgacgagtatgcccga
cagtggaaccagctgacaggtgattcagataccggtgatcaggtgtttgaggagtccgag
tacggatatttgttggccatcactttcaacatccataatatgctttgcttcatgtatgaa
caaggcgataaggatcccttgaatctccatagaaaaaaaaagggaggacatgcactctct
tctatttctctgtcttcttatgcctcttcttacgtgtggtccactggtgagtattccgct
cggagtttcagtgtgtttggatgtgaataa

DBGET integrated database retrieval system