KEGG   Aspergillus fumigatus: AFUA_1G02030Help
Entry
AFUA_1G02030      CDS       T01017                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCb
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_1G02030
Translation factors [BR:afm03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AFUA_1G02030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 740 aa AA seqDB search
MAPSFDTLSEQDLHEEEEEEIDFSDLKAQYEVKLEEGLDTFVVIDGLPVVPEESRQKLIK
FLLRKLNTVGHTSEDAVFMPLNDKNMSEGYAFVEFETPEQAVAAVKQLHGTPLDKKHTLL
VNKLMDIERYGREGRIDEEYKPPAIEPFKEKEHLRSWLADPNARDQFALYRGDKVGVFWN
NKNHPPENVVDRAHWTQLFVQWSPKGTYLASVHPQGVQLWGGPAFSKQKQFPHPFVQLIE
FSPGESYLTTWSARPIQVEEGQSILTYEEEGKNIIVWDIATGKPLRSFVSHDLTAGPAGD
AEPKKKVQWPAFKWSADEKYVARMLQHQSISIYELPRMNLLGKTSVKIDGVMDFEWSPAT
VTREGVKQYEQLLCFWTPEIGSSPARVAMMSVPSKEIVRTRNLFNVSDVKLHWQSQGLYV
CVKVDRHSKSKKSMATNLEIFRVREKGVPVEVVDSLKDTVINFAWEPNGNRFVLITTGEA
VAGAAVAPKTAVSFFAPEKKGGAIGNFKLIRTIEKKNSNAIYWSPKGRFVVVATVHSQTS
FDMDFWDMDFEGEKPEAEKDFAANLQLMKTTEHYGVTDIDWDPTGRYVVSSASVWTHQLE
NGWNLHTFAGQTLSENPTDKFKQFLWRPRPPTLLSKEEQKQVRKNLREYSKEFDEEDRYA
VDIANTAVVEKRKRVLNEWIAWIRREKELLAEEKDAYGLPEEADDPKLAKDAAATTQEQG
ETVVEEIVEEIIEESEEVIG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccagttttgatactttgtctgagcaggacctccacgaagaggaggaggaggag
attgacttctctgatctcaaggcgcaatatgaagtgaagctcgaagagggtttggataca
ttcgttgtgatcgatggactcccggttgtgcccgaggaaagcagacaaaagctcatcaag
ttcttgttgaggaaactcaacacggtgggccacacgtctgaagatgcggtctttatgcct
cttaacgacaagaacatgtccgaaggatatgcattcgtcgagttcgagacccccgaacaa
gctgtcgccgcagtcaagcagctgcacggcactccccttgacaaaaagcacacccttctc
gtgaacaaattaatggatatcgaacgctacggtcgcgaagggcgcattgacgaagagtac
aagccccccgccatcgagcctttcaaggagaaggagcatctccgctcgtggcttgcggac
cccaacgcgcgtgatcagtttgccctttaccgtggagacaaggttggcgttttctggaac
aacaagaaccatccgcccgagaatgtcgtcgaccgtgcgcactggacgcagctttttgtc
cagtggtctcccaaggggacttacctcgcatccgttcatcctcaaggtgttcagctctgg
ggtggtcccgctttctcgaaacagaagcaattcccccatcctttcgtccagctcatcgag
ttctcgcccggtgagagctatctgacgacctggtccgcgcgccccattcaggttgaagag
ggccagtctattttgacttacgaggaggaagggaagaacattatcgtgtgggatattgcg
actggaaagcctctacgttccttcgtctctcacgatctcactgctggtcctgcgggagac
gccgagcccaagaagaaggtgcagtggcctgcattcaagtggtccgccgatgaaaaatac
gtcgctcgcatgctacaacaccagtccatttcgatctacgagcttccacgaatgaacttg
ctcggaaagacatcggtgaagattgacggcgtcatggactttgagtggtcacccgcaact
gtgactcgggagggcgtcaaacaatacgaacagttgctctgcttctggactcctgaaatc
ggcagcagccccgctagagtcgccatgatgagcgtgccatcaaaggaaattgtacgaaca
cgtaatttgttcaatgtttccgacgtcaagcttcactggcagtcccagggtttgtatgtc
tgcgtgaaggtggatcgacactcgaaatcgaagaagtctatggccaccaacctcgagatt
ttccgggtacgcgagaagggtgttcctgttgaggttgttgacagtcttaaggatactgtg
atcaatttcgcttgggagcccaatggcaatcggttcgttctcatcacaaccggcgaggct
gtcgctggtgctgctgtcgcacccaagaccgccgtgtcgttctttgcccctgagaagaag
ggcggagcaatcggtaacttcaagcttatccgcaccatcgagaagaagaacagcaacgcg
atctactggtcgcctaagggtcgcttcgttgtcgttgctaccgttcactcccagaccagc
tttgacatggacttctgggacatggactttgagggagagaagcccgaagccgagaaggac
tttgccgccaaccttcaattgatgaagaccactgaacactacggtgtgacggatatcgac
tgggatcctaccggtcgttatgtcgtcagcagtgccagcgtgtggacacaccagttggaa
aacggctggaacctgcacactttcgctggtcagaccctctccgaaaaccccacagacaag
ttcaagcaattcctctggcgccctcgcccacccactcttctcagcaaggaggagcagaaa
caagtgcgcaagaaccttcgagaatactccaaggagttcgacgaggaggacagatacgcc
gtcgatattgccaatacagccgttgtcgagaagcgcaagcgggttctcaacgagtggatt
gcctggatccgccgggagaaggagctccttgccgaagagaaagacgcttacggtctcccc
gaggaggccgacgaccccaagttggccaaggacgccgctgcaaccacacaagagcaaggc
gagactgttgtggaggagattgtcgaagagatcatcgaggaaagcgaggaggttatcggt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system