KEGG   Aspergillus fumigatus: AFUA_1G02140Help
Entry
AFUA_1G02140      CDS       T01017                                 

Definition
glycogen debranching enzyme Gdb1
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afm00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1612 aa AA seqDB search
MASPQQVYLLPLKDDGSPDVPGGYIYLPPPSDPAYLLRFVIEGSSSICREGTLWVNIPEA
GKPFDRSAFRSFRLEPDFNKNIQLDVPVTCSGSFVFYTTFTPLPQFSVDPVPTPEPARTP
DYYVDVAPRLTLRGKDLPLNALSIFSVLSKFMGKYPTDWDRHLNGISQRNYNMVHFTPLM
KRGASNSPYSIFDQLQFDDGAFPNGEVDVAQMISKMEKEYGLLSLTDVVWNHTAHNSKWL
EEHPEAGYSVETAPWLEAALELDTALLKFGRDLEELGLPTEFKTVNDLLAVMTALQEKVI
SGIRLWEYYVIDVTANAGHILENWKASELKHSASKKYAEVDISGFKDRPLKQQADLIRQH
AIPTIKQVLGRFGRALDPEFGSLVLTAMFGKYDSSNSDIASIEKALVTILDEVNVPFYEE
YNADVSEIMNQLFNRIKYIRIDDHGPKLGPVTDENPLIETYFTRLPLNDITKKHSPKALA
LVNNGWIWNADAMRDNAGPESKAYLRREVIVWGDCVKLRYGSSPEDNPFLWDYMAKYTRL
MAKHFSGFRIDNCHSTPLAVAEYLLDEARKVRPNLTVFAELFTGSEEADYIFVKRLGINA
LIREAMQAWSTGELSRLVHRHGGHPIGSFDVELPSAGSSHAIASAGVNQNQEKISHIRPC
PVQALFMDCTHDNETPAQKRDARDTLPNAALVSMCASAVGSVMGYDEIYPKLVDLVHEKR
LYFSEFSQSAEVRHDCERGGIGGVKKLLNELHAMMGVEGYDETHIHHDGEYITVHRVHPK
TRRGIFLIAHTAFPGHSTNAVLAPTHLVGTQAKHIGTWNLEVDASDSMRAVILSDKDHLR
GLPSRIRKFEGTKAEQQGDDTVISVLDTFAPGSIALFETSIAKAEHAAGLENNITEGVDE
AFAELSLVDLNFVLYRCDAEERDLSGGQDGVYNVPNHGPLVYAGLQGWWSVLEDIIKYNA
LGHPLCDHLRHGHWALDFIVGRMERAAKKEGYTALEKPAKWLHEKFQAVRDLPSFLLPRY
FGIIIQVAYNAAWKRGIQLLGPDVRQGQEFIHQLGMVSVQVTGLVKSASLWPTKTVPSLA
AGLPHFAVDWARCWGRDIFISLRGLFLCTGRFDDAKEHILAFASVLKHGMIPNLLSSGKL
PRYNSRDSVWFFLQAIQDYTKMAPNGIEILNETVARRFVPYDDTWFAYDDPRAYSKHSTI
SEVIQEVLQRHAHGLSFREYNAGPDLDMQMKPEGFQIDVKVDWETGIIFGGSQHNCGTWQ
DKMGESGKAGNKGVPGTPRDGAAIEITGLLYSALTWVARLHERGLYPHDKVDIAEGRSIT
FKEWAAKIKQNFERCYYVPESPEEDGQYDVDPSVVNRRGIYKDLYKSGKPYEDYQLRANF
PIAMTVSPDLFTPSKALGALALADSVIVGPIGVATLDPSDLNYNPNYNNSEDSDNFATAK
GRNYHQGPEWVWQRGFFLRAFLHFDLERRKTAEERTEAYQQVTRRLEGCKRALRESPWKG
LTELTNKNGAHCADSVRCLPYLLYFHTRKLMQFCYSVPLSHGRQVAYLTYIMTPPDMEFC
ERSFDIDDLLKRIGYTVCIFKVDKVMISVYHRRYSQSHTFISFMEVVHYLCA
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccgcagcaggtttacttgctccctttgaaagatgatggctctccagatgtg
cctgggggatacatatatctcccaccgcccagtgatcctgcatatctattgcgtttcgtg
atcgagggaagcagttccatttgcagggaaggaacactatgggtgaacattcctgaggct
ggcaagccatttgatcgctcggcatttcggagcttcagattggagccagatttcaacaag
aatattcaattagatgttcctgttacctgttctggatcctttgtgttctataccacattc
acacccctacctcaattctctgtcgaccctgttccgacccctgaaccagcaagaacacct
gattactacgtcgatgtcgcacctaggttgacccttcgtggtaaagatttgcctctcaat
gcgctctctatattctccgtgttgtcgaaatttatgggcaaatatcccacggattgggac
agacacttgaatggtatcagccagcgcaactacaacatggtgcattttacaccgttgatg
aaacgcggagcttcaaattctccatacagtatctttgaccagttgcagttcgatgacggt
gcttttcccaacggtgaggtagatgttgcgcaaatgatctcgaaaatggagaaggaatat
ggacttttgtcactgaccgatgttgtgtggaatcacactgctcataatagcaagtggctc
gaggagcatcctgaggctggttatagcgtggagactgcaccatggcttgaggcagcttta
gaattggataccgccctattgaagttcggtcgggaccttgaggaactagggttgcccact
gaatttaagaccgtgaatgacttgctagctgtcatgaccgcactacaagagaaggtaatc
agtggcatccgtctctgggagtactatgtcattgatgtcacagcaaacgctgggcatatc
ctagagaactggaaagcttctgaattgaaacactccgcgtccaagaaatatgcggaagtg
gatatcagcggattcaaagataggcctctgaagcagcaggcagatctcatacgtcaacat
gccattcccacaatcaagcaggttttgggacggttcggcagagcgcttgaccctgaattc
gggtctctggtcttgactgctatgttcgggaagtatgactcttcaaactccgatattgcc
tcgattgagaaggcgctggtaactatactggatgaggtcaatgtgccattctacgaggag
tacaatgcagacgtctctgaaatcatgaatcaactgtttaaccgaatcaagtacatcagg
attgacgatcacggtccgaaacttgggcctgtcacggacgaaaatcctttgattgaaact
tactttaccaggttacctctcaatgatatcacaaagaagcatagtcccaaagcactagcc
cttgtgaacaacggctggatctggaatgcggatgctatgcgtgataatgctggtcctgaa
tcaaaagcctatttgcgtcgtgaagtcattgtttggggcgattgtgtcaagctcagatat
ggctcatctcctgaggataatcctttcctttgggactatatggccaagtacacccgcctt
atggccaaacacttctccggcttccggatcgataactgccactcaacgccactggcagtt
gcagaatatctgttggacgaggcgcgtaaagtccgaccaaatcttacagtctttgccgag
ctctttacggggtccgaagaagcggactacatcttcgttaagcggcttggtataaatgct
ttgattcgtgaggctatgcaagcctggagtactggcgagctaagtcggttggtccatcgt
catggcgggcaccccataggcagtttcgatgttgagctgccgtcagcgggaagcagtcat
gcaattgcctccgccggggtcaaccaaaaccaggaaaagatttctcatattcgtccctgt
cctgttcaagcacttttcatggattgtacacatgacaacgaaacaccagcacagaaacgt
gatgcaagagacacgttgcccaatgctgctctggtttcgatgtgcgcctctgccgtcgga
agcgtcatgggctatgacgagatatatcccaaactcgtggaccttgttcacgaaaagcgg
ctatacttttcggagttctcgcaatcggccgaggttcgtcatgactgcgaaagaggcgga
attgggggtgtcaagaagctgttgaatgaacttcacgcgatgatgggagtggagggatat
gatgaaacgcatatccaccatgacggagaatacatcaccgttcacagagtgcatcccaaa
acgcgcagaggaattttcctgatcgctcacactgctttcccaggacatagtactaatgcg
gttcttgcgcccactcatctcgttggaacgcaggccaagcacatcggaacgtggaacctg
gaagtagacgcaagcgatagcatgagagcagtaatcctatcggacaaagatcacctgcga
ggactgcctagtcgaattcggaaattcgaaggcacaaaggccgaacagcaaggcgatgat
accgttatttcagttctcgatacgttcgctccaggatctatcgcactctttgagacatcc
atcgccaaggctgagcatgcagcaggtttggagaataacatcactgagggagtagacgaa
gcttttgcagagcttagtctggtcgatctcaatttcgtcctttaccgctgtgacgcggaa
gaaagggatttgagcggtggccaggacggggtttacaacgtccccaaccatggaccgttg
gtctacgctggtcttcagggatggtggagcgtcttggaagatatcatcaagtacaacgca
ctaggccatccactttgcgaccatctccgtcacggccactgggccctagatttcatcgtc
gggcgcatggagagagccgcaaagaaggaaggatacactgcactggagaagcctgctaaa
tggttgcacgagaagtttcaggcagtccgtgatttaccaagctttctgttaccgaggtac
ttcggtatcattatccaggtagcatacaatgctgcttggaagcgtggcattcagctgctg
gggcccgatgttcggcagggacaggagttcatccatcaattgggcatggttagtgtgcag
gtaactggccttgtgaaatccgcatctctttggcctacaaagactgtccccagccttgca
gctggtcttccgcattttgcagtggattgggcgagatgctggggccgtgacatcttcata
tcccttcgtggcctctttctttgcaccggccgttttgatgacgccaaggagcatatccta
gcatttgccagcgtgctcaaacacggcatgatcccgaatctcctaagtagtgggaagtta
ccccggtacaactcccgggattccgtgtggttcttcctccaggccatccaagactacacc
aagatggcacccaacggcattgagatcttgaacgagacggttgccagacgttttgtgcct
tatgacgatacctggtttgcgtatgatgaccctagggcatattcaaagcattcgactatt
tcggaggttattcaagaagtgctccaacgacacgcgcatggattgtcattccgagagtac
aacgctgggcccgatctcgacatgcaaatgaagccggaaggctttcagatcgatgtcaaa
gtcgactgggagacgggaataatcttcggtggtagtcaacacaactgcggtacgtggcaa
gacaagatgggagaaagcggaaaggcgggaaacaagggcgtgcctggtacgcctcgcgat
ggtgccgcaatcgagatcaccgggctgctttatagcgctttgacttgggtcgcccgcttg
catgagcgcgggctctacccacacgataaggttgacattgcggaagggaggtccattact
ttcaaggaatgggcggcgaagatcaagcagaactttgaacgctgttactatgtcccagaa
agccccgaggaagatggtcagtatgatgttgaccccagcgtagtcaatcgccggggtatc
tacaaggatctatacaaatccggcaagccatatgaggactatcagctccgcgccaatttc
cccattgccatgaccgtgtctccagacctttttacgccgtcaaaagcgttgggagctctg
gctctcgcagactctgtcattgtcggccccatcggtgtcgctactttggatccatccgat
ctcaactataatccaaattacaacaactcggaagactcggacaatttcgcgactgccaag
ggtaggaactaccaccaaggacccgaatgggtctggcagcggggattcttccttcgtgct
ttcctgcactttgatcttgagcgccggaagacagcagaggaacggacggaggcgtatcag
caagtgactcgacgcctagagggttgcaagcgcgcgctgagagagagtccatggaagggc
ctcacagagcttacaaacaagaatggggctcactgtgcagactctgtaagatgcttaccc
tacttgctgtacttccatacgagaaagctgatgcaattctgctatagtgtcccactcagt
catggtcggcaggttgcttacttgacctatattatgacgcctccagacatggaattttgt
gagagaagctttgatattgatgatttgttgaagaggattggatataccgtttgcatattt
aaagtagataaagttatgatatccgtataccatagaagatactctcagtcccatacgttt
atctcattcatggaagttgtgcactatttgtgtgcatag

DBGET integrated database retrieval system