KEGG   Aspergillus fumigatus: AFUA_1G04390Help
Entry
AFUA_1G04390      CDS       T01017                                 

Definition
cytochrome P450 monooxygenase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
afm  Aspergillus fumigatus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AFUA_1G04390
  Amino acid metabolism
   00380 Tryptophan metabolism
    AFUA_1G04390
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AFUA_1G04390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 527 aa AA seqDB search
MVVSIYTSLSIVILLLFVAYKAIVYPVFLSPLAKIPNAHWSAPVSPAWILWKRFRSQNNS
TIHAAHERLGPIVRLGPSEISINCVEGGIKTVYSGGFEKHEWYPRVFGSFGTVSMFTMTG
SKDHSVRKRMLSNIYSKSFLQSSPHMRLISRTIVYDRLLPILYDAATSSRPVDVHDLNQG
LTMDFVSAYLYGVTNGTNFLQDAPYRQRMLHLYQSRKPFEFYHQEVPNLLSWTKSLGIRL
IPRYCDQANEILDSWGLGLCDKAEESLKSNRLEDEPAVYKHLKQMILKHLPENKNDVEYA
RILEQQRLDIACEMYDHLTAGHETSAVALTYLLWELSKRPELQDALRAELSTLEPMVIFP
RPSESAELPPAKSIDSLPLLEAIVTETLRLHAPIPGIQPRVTPYPSCTLAGYNNIPPKTR
VNAQAYSLHRNPEVFPDPETWEPKRWLKDVNTPSELEERRRWFWAFGSGGRMCVGSNLAL
QEMKLVVAAVYTNFKTSIVSDDNMEAIDAYTVKPTGESLILRFELVE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtggtctccatatacacgtcactttcaattgtgattttgctacttttcgtagcatac
aaagcaattgtgtatccagtctttctatcgccgctcgcaaagataccgaatgcacattgg
tcagcccccgtctcacctgcttggatactctggaagcgttttcgaagtcagaataatagt
acaattcatgcggctcatgaaagacttgggcctattgtgcgattgggcccatcagaaatc
tcgataaattgcgttgaaggaggtatcaagacggtgtatagcggaggctttgagaagcat
gagtggtatcctcgggtcttcggatcgtttggaactgtcagcatgtttaccatgactgga
agcaaagatcactcggttcgcaagaggatgttatccaacatctacagcaagtcgtttctg
cagtcgtcacctcatatgcgtcttatctcgaggactatagtatatgaccgtcttctacca
attctatacgatgcagcgacttcaagtagacctgtcgatgttcatgacctcaaccaggga
ctgacaatggacttcgtatcagcatatctatacggcgtcacaaatggcaccaatttcctc
caggacgcgccttataggcaaaggatgctccatttataccagagcaggaagccatttgag
ttctatcaccaggaagttcctaatctcctttcttggacaaagtctttgggtatccgcttg
ataccaagatattgcgatcaggccaacgagatccttgactcttgggggctgggactgtgt
gataaagcagaggagtcgctaaagtcaaacagacttgaggatgagccggccgtctataaa
caccttaagcagatgatattaaagcacctgcccgaaaacaagaatgacgtggaatacgca
cggatcctcgagcagcagcggcttgatattgcctgcgagatgtacgaccacctgacggcg
ggtcatgaaaccagcgccgtcgctcttacatatctcctttgggaactctcgaagcgccct
gaattacaggacgcacttcgggcggagctctccacccttgagccgatggttatcttccct
cggccgtccgaatctgcggagttgcctccggcaaaatcgattgactccttgccgctgctt
gaagcaatagtcacggagacactgcgcctccatgctccaattccaggaatccagcctcga
gtcacgccgtatccgtcttgcactttggcgggatacaacaacatccctcctaagactagg
gtcaatgcgcaagcttattcccttcaccgcaatcccgaggtgttcccagatcctgagact
tgggaacctaagcggtggctgaaagacgtcaatactccttctgagttggaagagagaagg
cgctggttctgggcttttgggagtgggggaagaatgtgtgtaggcagtaacttggccttg
caagaaatgaaattagtggtggctgctgtttacactaatttcaagacttccatcgtcagt
gacgataacatggaagcgattgatgcatataccgtgaagccaacaggagagagcctgatc
ctccgatttgaactagttgagtag

DBGET integrated database retrieval system