KEGG   Aspergillus fumigatus: AFUA_1G05320Help
Entry
AFUA_1G05320      CDS       T01017                                 

Definition
disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
afm  Aspergillus fumigatus
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:afm04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 478 aa AA seqDB search
MMQPSSALLLVASLLAASSVNADGLYTKKSPVLQVTQKTYDQLIANSNYTSIVEFYAPWC
GHCQNLKPAYEKAAKNLEGLAKVAAVNCDDDANKPLCGRMGVQGFPTLKIVTPSKRPGKP
KVEDYQGARSAKAIVDAVVDRIPNHVKRVTDKDLDQWLSEDQESPKAVLFTEKGTTSALL
KAVAIEFLGSIKVGQIRNKESKAVEKFGVKEFPTLVLVPGGDKEPIIYDGELKKQAIVEF
LSQVAAPNPDPAPASTDAKSSKATKSAKSPKSSTILSEEAENLKPTASPDPKVVPDDATE
SKPAQVPIQAPPIPVLPTAEELEAACLKPTSGTCVLALLPEPREGDADVSSPAKEALTSL
SEIAHKHAQRKSKLFPFYSIPAINSGAKTLRAGLGLSEDQTSVEIIALNGRRGWWRRYDA
SEAQDYGAVSVEAWIDAIRLGEGSKSKLPDGVIVEQKEEGDVEAKKDADKEKGDHDEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagccaagctctgcacttctgctcgtggcatcgcttctggcggcttcgtccgtt
aacgcagatggactgtacactaaaaagtctcctgttttgcaggttactcagaagacctat
gaccagctgattgctaactctaattacacatcgatcgtagaattctatgctccttggtgt
ggccattgccagaacctcaaacctgcatacgaaaaggcagccaagaacctggagggactg
gccaaggtagcggctgtgaactgcgatgacgatgccaacaagcctttgtgtggtcggatg
ggcgtacagggtttcccaactctgaagatcgtcactccttccaagagacccggcaagcca
aaagtggaggattaccagggagcaagaagcgcaaaggcgatcgtcgatgctgttgtggac
cgaatcccgaatcatgtgaagagggtcacggacaaggatttggatcagtggctctccgag
gaccaggagtctcccaaggctgttctgtttactgagaaaggtactacgagtgccctcctc
aaggccgtcgccattgagttcctcggctccatcaaggtcggccagattcgcaacaaggaa
tccaaggccgtggagaaatttggtgtcaaggaatttcctaccctcgtcctagtccctggc
ggcgataaggagcccatcatctacgatggcgaactcaagaaacaagccatcgtcgagttc
ctcagccaagtcgcagctcctaaccccgacccggcccccgcctcaaccgacgccaaatcc
tccaaggccaccaagtccgctaagtcgcccaaatcctccactatcctcagtgaagaagcc
gaaaacttgaaacctaccgcatcccccgacccaaaggtcgtccctgatgacgccacagag
tcaaagcccgcccaggtcccgatccaggcaccacccatccccgtactccctacggcagag
gaactcgaagccgcctgcctaaagcctacatctggtacctgcgttctagcacttctccct
gaaccccgcgaaggggatgcagacgtgtccagtcccgcgaaggaggcgctaaccagtcta
tcggagatcgcgcacaagcacgcccagcgcaagagcaagcttttcccgttctacagtatt
cccgctatcaacagcggggccaagactctacgggctgggctgggattgtccgaggaccag
acctcagtcgagatcattgctctgaatggacgcagaggctggtggaggcgctacgacgcg
tcggaggctcaggattatggcgccgtgtctgtggaggcgtggatcgacgccataagactg
ggtgaggggtcgaagagcaagttgccagatggtgttattgtcgagcagaaggaggagggt
gatgtagaggccaaaaaagacgctgataaagagaagggtgaccatgatgagttgtaa

DBGET integrated database retrieval system