KEGG   Aspergillus fumigatus: AFUA_1G07160Help
Entry
AFUA_1G07160      CDS       T01017                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
afm  Aspergillus fumigatus
Pathway
Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    AFUA_1G07160
Enzymes [BR:afm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AFUA_1G07160
Peptidases [BR:afm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AFUA_1G07160
Ubiquitin system [BR:afm04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AFUA_1G07160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 872 aa AA seqDB search
MMNHHLPAMPHGQPPMPPPRRQQDLPYAGGPPNMRSPPAYMGYHPHLNGHPPPAYSPQQY
GHWYPAYPQMQLPPRPFQPPYAPMIVSSFPHSPPVMAPSHMPPPSLAMQPRTATPLQSTM
SPPVGPAPVPLNMQAQSPADIPVHFTPSPVVSSPSASAPVINAVLAPSEPFRAPLPWLSV
PDRPFPARTPHRRRKGRSLQISSVSVELPSKEPQLAKQEERLDEEKPVQQTVQEQSEPQT
PSPSAAPSVADSTTQPTTPSSAVASTTARPQSHSKGPKPAVPVVPVLPVIPSPVAHQRQP
PKDDVSRAPETPKSTTASATSANETPKEDAVKETAKAASPPRAAPKSWADLVRAKGASRV
SGPAGALSIESNGLVMRKSESLADVLTSLGEDVSQYSDKIAFLEPRGLINTGNMCYMNSV
LQILVSCIPFYQFLDHVGRRISHSVQSAFPMVDAMIMFMKEFRVIDAAPSEEQLRLRLKP
NELEDYGEAFTPDFVYEVIRQLSRFRDMQRGHQQDAQEFLGFLLEEMHEECVRAAKNAST
TKPAASITAESIDKEEQSGDGWLEVGHKQKAAITRSSGHITQESPITRIFGGKIRSEFKV
PGNKTSVTLEPYQPLQLDIGSPDIHNIVDALKGLTKPESIQGDFNSSRGPNVTATKQIFI
ENLPPVLILHLKRFQYDSVTRGTQKIWKKIGYPLDLEIPREVFAPNKRNVMMAHGGLPKY
RLIGVIYHHGRNASGGHYTVDVRRQDGREWIRLDDTVIRRIKSEDVAEAGGEEDPKVLAA
ALEQHKRDNTSNANIFGHIDQDDQDQSDNERGWSQVNGTSTGGHSSKKSTSTVLNGASAT
ASGSSSGVRTPIGRYGSRDNKVAYLLFYQRVA
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccatcatctgcccgcaatgccccatgggcagccacccatgccgcctcctcga
cgacagcaagatctgccttatgctggagggccgccgaatatgcgctctccgccagcctat
atgggttatcaccctcacctgaatggccatccacctcctgcttactcaccgcaacaatat
ggtcattggtatccagcgtatcctcaaatgcaacttcctcctcgaccatttcagcctcca
tatgcgccaatgatcgtctcatcgttccctcattcgccacctgtgatggctccatctcac
atgccacccccgtcgcttgcaatgcagcccagaactgcgactcctcttcaatctaccatg
tctccgcccgtcggaccggcgcctgtcccattaaacatgcaggctcagtctcctgcggat
attcctgttcatttcacacccagtcctgttgtatcctcgccatctgcttcggcgcctgtg
ataaatgctgtcctggctccgagtgagcctttccgtgctcctttgccttggctctcggta
cccgatcgtcctttccctgccagaacccctcacagacgtcgaaagggtcgcagtctacaa
atctcatctgtctcggtcgagttgccttcaaaggaaccgcaactagctaagcaggaggag
agactagatgaagagaagccagtccaacagactgtgcaagaacaatcagaaccgcagact
ccatccccatccgctgctccttcggttgcggattcgacgacgcagcccacgacaccgtct
tcagctgttgcttctacaacggcccgccctcaatcacactcaaaagggccaaaacccgcc
gttcctgtggtgcctgttttgcccgtcatcccaagccctgtagcccaccaacggcagcca
cctaaagacgatgtgagccgtgctcctgaaactcctaaatcaacaacagcctctgctacc
tcagcgaacgagacaccaaaagaagatgccgttaaagagacagctaaggcggcttcacct
cctcgtgctgcccctaagtcttgggcagaccttgttcgagcaaaaggagcctcgagagtc
tcgggcccagctggtgctctctcaatcgagtctaacggcctggtcatgcgcaagagcgaa
tctctggcagatgttctaaccagtcttggggaggacgtttcccagtacagcgacaaaatc
gcctttcttgaaccaagagggcttataaatactgggaacatgtgttacatgaactcggtc
cttcaaattctagtctcctgcataccgttctatcagttcctggatcatgtcggcagacga
atatcacatagcgtccagagcgcatttcctatggttgacgccatgatcatgttcatgaaa
gaattccgtgtcatcgatgctgctccttcggaagaacagttgaggcttcggttgaaacct
aatgagctcgaagattatggcgaagcttttaccccggactttgtatacgaagtgattcga
caattatctcgattccgggacatgcaacgaggccaccagcaggatgctcaagaatttctg
ggattccttctggaggaaatgcacgaagaatgcgttcgagctgcgaaaaacgcgagcacg
acaaaacctgcggcttcaataactgctgaatcgattgataaagaggagcagtctggagat
gggtggctagaagtcggacacaaacaaaaggcggcaatcacacgttcttccggtcacatc
acgcaggagtctcctatcaccaggatatttggtggcaagatcagatcggagttcaaggta
cctggcaacaagacttccgtgaccttggagccttatcagcctctgcaactcgacattggc
tctcccgatattcacaatatcgttgacgctctgaaaggtctaaccaagccggagagcatc
caaggtgactttaactcttctcgtggtcccaatgtcactgccaccaagcagatattcatt
gagaatctgccgcctgtcctcattctccatttaaagcggttccagtatgacagcgtgacc
agaggtacgcagaagatttggaagaagatcgggtatcccttggaccttgagattccccga
gaggtcttcgctccgaacaaacgcaatgttatgatggctcatggtggtctgcccaaatac
cgtctcattggtgtcatctatcaccatggcagaaacgctagcggcgggcattatacggta
gatgtacgccgtcaagacggccgcgagtggattcgcctcgacgatacggttattcgccgg
atcaaaagcgaggatgtcgcggaagccggcggcgaggaagatccgaaggtgctcgctgct
gcgcttgagcaacacaagcgagacaatacctccaatgctaacatctttggtcatattgac
caggatgatcaggaccagtctgacaatgaaagaggctggagtcaagtgaatggaacaagc
acgggaggccattcgagcaagaagtccacctccaccgtcttgaatggggcatctgccact
gcttcgggaagttcttccggcgtcaggactcccatcggccgatatgggtctcgtgataac
aaagttgcatatcttctcttctatcaacgtgttgcttga

DBGET integrated database retrieval system