KEGG   Aspergillus fumigatus: AFUA_1G07690Help
Entry
AFUA_1G07690      CDS       T01017                                 

Definition
protein O-mannosyl transferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
afm  Aspergillus fumigatus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AFUA_1G07690
Enzymes [BR:afm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     AFUA_1G07690
Glycosyltransferases [BR:afm01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AFUA_1G07690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 759 aa AA seqDB search
MSAPICGVGMFTPERKLISSSHLIIPRTRTRTQSRGLRYGGHTHPVSPAERHILSPANDP
FTEQANSFYTILDSWEPFIAPIVLTAFAVFTRMYRIGRSNIVTWDEAHFGKFGSHYLKRE
FYFDVHPPLGKMLVGLSGLLAGYNGSFEFKSGEKYPEDVNFTFMRVFNAAFGVACVPLAY
YTARELGFRKATVWLISLMVLFENSYATISRFILLDSMLLCFTFMTTMCWAKFHRLQHAS
FSGQWFTWLFLTGISIGCVCSVKWVGLFCTALVGLYTIEDLWNKFGDLRMPKTVLVNHLL
ARVVGLIIIPAVVYMLSFYVHFWILENSGPGDAQMSSLFQANLKGTEVGKDSPLEIAVGS
RVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDASGPLS
FVGDGDVIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDVAS
RDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNVES
HFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGL
RMCSWDDNTIKYYLLGNPFVYWGSTFSLGVFGLLIFWYLARWQRGYKDLNQADIDHIHYS
GFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLYAF
LYVIIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctccgatttgcggcgtaggaatgttcacgccggagagaaagttgataagctct
tctcatctcataattccgaggacaaggacaaggacgcaaagtcgaggcctcaggtatggc
ggtcatactcatcctgtttcacctgcagagcgtcacatcttatctccagctaatgaccct
tttaccgaacaggccaattctttctacacaatactagatagttgggaacctttcattgcg
ccgattgtgctgacagcctttgctgtcttcacccgtatgtaccgcataggtcgctcgaac
attgtgacatgggatgaagcccactttgggaaattcggttcacattacttgaagcgggaa
ttctactttgatgttcacccgccactgggcaagatgcttgttggcttatccggtctcctt
gctggctacaacggatcctttgaattcaaatcaggagagaaatacccagaagatgtcaac
tttacattcatgcgtgttttcaacgccgccttcggtgtcgcgtgcgttcctcttgcttat
tacactgctcgagagctcggtttccgcaaggccactgtttggctaatcagtctgatggtt
ttgttcgaaaactcttacgcgactatttcaaggttcatattgcttgactcgatgttactt
tgcttcacctttatgaccaccatgtgctgggctaagtttcatcggctacagcacgccagc
ttctcaggtcagtggttcacgtggctcttcctgacgggtataagtatcggctgcgtatgc
agtgtcaaatgggtgggtcttttttgcacagcattagtgggactttatacaattgaagat
ttgtggaataaatttggcgatcttaggatgccgaagacagtcctcgtcaatcacctattg
gctcgcgtggtcggattgattattataccagctgtggtatatatgctttccttttacgtc
catttctggattcttgagaacagtggaccgggcgacgcgcagatgagctctctctttcag
gccaacctaaagggcaccgaagttggaaaggacagccctctcgaaattgccgttggctct
agggtcactttaaaaaatatgggttatggtggaggactgctgcattctcatgttcaaact
tatcccgacggctccaatcagcagcaggtcacttgttaccaccacaaagacgcaaacaac
gattggtttatttaccccaatcgccatgaacctgagtatgacgccagcggacctctgtct
tttgttggtgatggcgatgttattcgtcttattcatgggcaaacgggccgaaaccttcat
tcgcatgccatcccagctcctatcaccaaatctcaatatgaagtctcctgctacggtaac
atcactattggagacgaaaaagatcactgggcagtggaggtcgtggatgatgtcgcgtca
agggaccgaagcaggatccgaaccctgacaactgcattccgcctgagacacatcgttctg
ggctgctatctgcgtgccggcaacgtgaacctcccacagtgggggtttaagcagatcgag
accacatgcgtcaaagagaacaatcctcgcgatgtctacacgcattggaacgtagagtct
catttcaatgatcgactcccacctggtgatccaggatcgtacaagtcccccttttttaag
gattttattcatctgaatgttgccatgatgacatcgaataacgcgcttgttcctgatcca
gacaaacaagatgaccttgcgtcaaaattctggcaatggcccatacttaatgtgggcctt
cgtatgtgctcctgggatgacaacaccattaagtattacctcctcggaaatccctttgtc
tactggggcagtacattcagtctcggagtttttggactcttaatattctggtatctcgcc
cgctggcagcggggttacaaggatctcaatcaagcggacatcgatcacatccattattcc
ggcttctatcctcttctcggatggatcctacactacttccctttcataatcatggctcgg
gtgacctacgttcaccattattaccctgcgctctactatgccatactcaccttcggtttt
tgtgtcgactggcttactcagaaaatgagtcctgtggctcgtgggtctctgtatgccttc
ctttacgtgatcattatcgggatgtttgttcattttcgggtcattgtgttcggcattgag
ggacctagccagcagtgggccaatctgaactggctgagcggttggcggattgcgaattga

DBGET integrated database retrieval system