KEGG   Aspergillus fumigatus: AFUA_1G08760Help
Entry
AFUA_1G08760      CDS       T01017                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
afm  Aspergillus fumigatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFUA_1G08760
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AFUA_1G08760
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFUA_1G08760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 373 aa AA seqDB search
MSFSNLVSDLAFRDAYDDRSSQISHSRSQATARSYTSTAATSVSISGDISSQLHAGYSHP
LTRSWQAERQLTKEMLIYPLFITDNPDEETPIPSLPNQHRRGLNRLVPFLRPLVQKGLRS
VILFGVPLHPTAKDALGTAADDPSGPVIQAIRLLRSRFPNLYIVTDVCLCEYTSHGHCGI
LREDGTLDNAQSVDRISDVALAYATAGAHCVAPSDMNDGRVRAIKLKLIEAGLAHRVLLM
SYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDVGEGADIIMVKPA
SSYLDIIRDAKELAKDMPIAAYQVSGEYAMIHAAAKAGVFDLKSMVFESTEGILRAGAGI
IVSYFVPEFLDWL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctcaaatcttgtgtcggatcttgcctttagggatgcttatgatgatcgcagc
tctcaaatatcccattcacggtctcaggccaccgctcggtcatacacaagcacagctgct
acaagtgtcagtatttctggagacatttcaagccagctgcatgccggatatagccatcct
ttgacgagatcatggcaagctgaaagacaattgaccaaggaaatgctcatctacccatta
ttcatcaccgacaatcccgatgaagagacaccaataccatcactgcctaaccagcatcgc
cgaggtttgaaccgccttgttcctttcctcaggccacttgttcaaaagggactgcggtcg
gttattttgtttggggttccactacacccgaccgcaaaggatgccctgggtactgctgcg
gatgatccttcgggcccggttattcaggctatccgtcttctcaggtcacgcttccctaat
ctctatattgtgactgacgtttgtctctgcgaatacacatctcatggtcactgcggcata
ctacgagaggatgggacactggataacgcccagtctgttgatcgaatttcagatgtcgct
cttgcctacgctactgctggtgcgcactgtgtcgctccatccgacatgaatgatgggaga
gttcgcgctatcaaactaaagttgattgaagcaggcttagcccatcgcgttctcttgatg
tcctacagcgcaaagttcagtggttgtctctatggaccattccgtgacgcagccggttct
tgcccctctttcggtgaccgcagatgttatcagctgccgccgggaggccgtggactcgcc
cggcgagcaattcagcgagatgtgggtgaaggtgcagacatcataatggtgaagcctgca
agtagttatctggatatcatcagggatgcaaaggaacttgcaaaggatatgccaattgca
gcgtaccaggtcagtggtgagtatgctatgatccatgccgctgccaaggctggggtgttt
gatttgaaatcgatggtgtttgaaagtacagaagggattctcagagccggcgctggaatc
attgtgagttattttgtaccggaattcttggactggctttag

DBGET integrated database retrieval system