KEGG   Aspergillus fumigatus: AFUA_1G09020Help
Entry
AFUA_1G09020      CDS       T01017                                 

Definition
nuclear pore complex protein (SonA)
Orthology
K14298  
mRNA export factor
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_1G09020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MSLFGNVGATSTTAGQTNTTGDISKDVPLSSPPEDGISDLRFSPASEHLAVASWDKKVRI
YEINEQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARMLDLAANATTPVQVAAH
DAPIRCCHMIPNPAGNSPLLVTGSWDKTIKYWDLRQSTPIATVECQERVYTMDVKNKLLV
VGTADRYIDIINLDNPTKFYKTIQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDK
DSSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLK
GYPSVGGTISSTAFNRNGNIFAYAVSYDWSKGYSANTQQLPNKVMLHPVAPEEVKPRPGT
RKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttattcgggaacgtcggcgctacgtcgacaacagctggtcaaacaaacaccaca
ggcgatatctccaaagatgtaccgctcagctcgccgcccgaagacggcatctctgatctt
cggttttctcccgcaagcgaacatctcgcggtagcttcatgggacaagaaggtccgcatc
tacgagatcaacgaacagggtcagagtgaagggaaagctcttttcgagcatgaagctcca
gtcttgaattgttgctggtcaccggatggaacgaaagtcgtcggagcaggtgccgacaaa
gctgcacggatgctggatctcgcagccaacgctactacacccgttcaagtcgctgcccac
gatgctcctatccgatgctgccatatgatacctaatccagctggaaactctcctcttctt
gtgactggttcatgggacaagaccatcaaatactgggacctgcggcaatccacccctatt
gcgacggtggagtgccaggagcgcgtctacaccatggatgttaagaacaagctactagtg
gtgggaacggcagatcgatacattgatatcatcaatcttgacaatcccacaaagttttat
aagaccattcagtcaccactcaagtggcaaacacgggtagtcagctgctttacggatgcc
actggtttcgctgttggcagtatcgaaggacgttgcgccattcaatatgttgaggacaag
gactctagttccaacttcagcttcaagtgtcatcgcgaaactcctccaaaccaacgagat
atcaacaacatttactcggtgaatgccatctccttccatccggtccacggcaccttcagc
actgcaggtagcgacggtaccttccatttctgggacaaggatgccaagcatcgtttgaag
ggatacccgtctgtgggaggcacgatctccagcaccgccttcaaccgtaacggtaacatc
tttgcatatgctgtcagctacgattggagtaaaggatattcagcgaacacgcaacaactt
cccaacaaggtcatgctccacccagtagcgccagaggaggtgaagccaagacctggtacc
cggaagaggtag

DBGET integrated database retrieval system