KEGG   Aspergillus fumigatus: AFUA_1G10980Help
Entry
AFUA_1G10980      CDS       T01017                                 

Definition
sphingosine kinase (SphK)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
afm  Aspergillus fumigatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFUA_1G10980
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AFUA_1G10980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 486 aa AA seqDB search
MASSDGATRPSFNADQPDSQSQLLQPESTLTVGQSVTLTLGNDALVIVETKETQSIALYN
ILHAEVSSAGLTITYADPVTKHDVTVGALQYTIADEDKAKAETFAARLLDLAYGNAKRYR
RFKVLINPFGGKGIASRLYHQYAAPILAAAHCVVEVEETTHGGHATEIAEQIDIDAYDAI
VCCSGDGLPYEVFNGLAKKPNAREALSKLAVAMIPGGSGNAMAWNLCGTGSVSVAALAIV
KGVRTPIDLVSVTQGKTRTLSFLSQSFGIVAESDLGTDNIRWMGAHRFTYGFLVRLMQRT
VWPCDLAIKVEIDDKKAIKEHYRKYAAGEPPRRPSEDTVAGSGGLPDLKYGTVLDELPQD
WEVVPGESMGNFYAGNMAIMSADTNFFPASLPNDGLIDVVTIDGTISRLTSLKMMTEIPE
GGFFDMPDVRIRKASAYRLTPREKEGYISVDGERIPFEPFQVEVHRGLGTVLSKSGHLYE
AEGPRP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccgacggcgctactcgcccttcgttcaacgcggatcagccggattcccag
tctcagttacttcaacccgagtcgaccttgacagttggacagtcagttaccttgactttg
ggtaacgatgctcttgttattgttgagaccaaggaaactcaatctatcgcattgtacaat
atccttcatgcagaagtctcctctgctggtctgactattacatatgcggaccctgtaacc
aagcacgatgttaccgttggtgccttgcaatacaccattgcagacgaagacaaagcaaag
gccgaaacatttgcggccaggttacttgatctggcgtacggtaatgccaagcgctacaga
agattcaaggttctgatcaacccgtttggtgggaaaggtattgcctcgcgattgtatcat
caatacgcggcgccgatccttgctgctgcgcattgcgtagtggaagtagaagaaacaaca
catggaggacacgccaccgagatagcggaacagattgacatagatgcatatgatgcaatt
gtatgctgctctggtgatggattgccctacgaggtcttcaatggtctggccaagaaacct
aatgctcgtgaggctctatctaagctcgctgtcgccatgatacctggtggttctgggaac
gccatggcttggaacctttgcgggacgggtagtgtctctgttgctgcgctggcgattgtc
aaaggagtaaggactccaattgatctggtctctgtcacgcagggcaaaactcgaacccta
tctttcttgtcacaatctttcggtatcgtcgcagaatctgacttaggaaccgataatatc
cggtggatgggtgcccatcgcttcacctacggtttcttggtccgtctcatgcagcgcaca
gtgtggccatgtgacctcgcgataaaagtggagatcgatgacaaaaaggcgataaaggag
cattacagaaagtacgcagccggagaacctccccgccgcccgtctgaagacaccgtcgcc
ggatcgggagggcttcccgacttgaagtacggcacggtcttggatgaactcccgcaggac
tgggaagtcgtcccgggtgagagcatggggaacttctacgcgggcaatatggccattatg
tccgcagatacgaacttcttcccggcttccctgccaaatgacggtctgatcgatgttgtt
acaattgatggaaccatcagccgcctcacatcgctcaaaatgatgacagagatccctgag
ggaggattttttgatatgccggatgttaggattcgtaaggcttcggcatatcgactcact
ccccgggagaaagagggctacatcagtgtcgatggtgaacgtataccctttgagccgttt
caagtcgaagttcatcgtggtctaggtacggtgttgtcgaagtccgggcacctttacgag
gccgagggtccgaggccatga

DBGET integrated database retrieval system