KEGG   Aspergillus fumigatus: AFUA_1G12940Help
Entry
AFUA_1G12940      CDS       T01017                                 

Definition
(RefSeq) MAP kinase SakA (EC:2.7.1.-)
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
afm  Aspergillus fumigatus
Pathway
MAPK signaling pathway - yeast
Regulation of mitophagy - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:afm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_1G12940
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    AFUA_1G12940
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AFUA_1G12940
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AFUA_1G12940
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AFUA_1G12940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 366 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSARDQLTGQPVAVKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
ICSENTLRFVKSLPKRERQPLANKFKNADPEAVDLLERMLVFDPKKRIRAGEALAHEYLS
PYHDPTDEPEAEEKFDWSFNDADLPVDTWKIMMYSEILDFHNIDQGNDAGQVLMEGGVAQ
AQQNYA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgtgcgtgcccagattttcggcaccacctttgagatcactagcaggtat
acagatctgcaaccggtgggaatgggagcctttggacttgtctgctctgcaagagatcaa
ttgacaggccaacccgtggctgtaaagaagatcatgaagcctttcagcactcctgttttg
tcgaagagaacataccgtgagctgaaactgttgaagcacttacggcacgagaacatcatt
agcttaagcgatatcttcatctctcctctcgaggacatttactttgtcacagagctcctt
gggacagacctccaccgacttctaacttcgagaccattggagaaacaattcattcaatac
ttcctatatcagattttgcgaggtctgaaatacgttcactcagcaggcgtcgtccaccgt
gatctcaaacccagcaacattcttatcaacgaaaactgcgatttgaaaatctgcgatttt
ggccttgctcgtatccaagaccctcagatgaccggctatgtttcaacgagatactaccga
gcccctgaaatcatgcttacatggcagaaatatgacgtggaagtcgacatctggagtgca
ggctgtatttttgccgagatgctggaaggaaagcctttatttcctggaaaggaccatgtc
aaccagttctctatcatcacagaactgcttgggactccgccggacgatgtgattcaaact
atctgcagtgagaataccctgcggtttgtcaagtccctaccgaagcgtgaacgtcaacct
cttgccaacaaattcaagaacgctgatcctgaggcggtcgatcttctagagcgaatgctc
gtttttgatcccaagaagaggatccgcgcgggggaagcacttgcgcacgaatacctctct
ccctaccacgaccctaccgatgagcctgaggctgaggagaagttcgattggtcattcaat
gacgccgaccttcccgtggatacctggaagattatgatgtactcggagattctcgacttc
cacaacatcgaccagggtaacgacgctggccaggtgctcatggaaggaggcgtggcccaa
gcgcaacaaaactatgcataa

DBGET integrated database retrieval system