KEGG   Aspergillus fumigatus: AFUA_1G15120Help
Entry
AFUA_1G15120      CDS       T01017                                 

Definition
dsDNA-dependent ATPase (Rad54b)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
afm  Aspergillus fumigatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afm03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 969 aa AA seqDB search
MVFKPFKPPLIRKQPDLSVSDAPPASGAAEHHEPLAKKQRLDLEITTHSKSLNRSYTPSR
KLLQQVINAGSSPSESTTSDDSYGDRYYNVLWRKPSTKKNKTWDGDGIVSARDGYLYLQD
ISGKDMGRVMHGSQLEAGTILSIGGKEVEIDSEIPRKEYLAGRPFIERKDVTGPVTAPAP
PKKTFTHLLGNRSGTSLLTTPCQKNQGGRIGSSALSNLASRPSSTSNAYKRPLLESTVVP
AGPVGKPVPRHDPNQPGALVMKRPDSVPKGKQIVDVVVDPILSKHLRQHQREGVQFLYEC
VMGMRSFNGEGAILADDMGLGKTLQTITLLWTLLKQNPIHESPPVIKKALIVCPVTLINN
WRKEFRKWLGNERIGVFVFDDKRKRLTDFTMGRAYSVMIVGYEKLRTVQEGLARGAGVDI
IIADEGHRLKTLQNKSGQAIQSLNATKRIILSGTPIQNDLKEFFAAVDLVNPGILGNFKA
FVREFEGPIVKSRQPEATKKEIEKGEARNEELRELTSKFMLRRTVDILAKYLPPKTEYVL
FCNPTSTQATIYKNVLASPVFQCAIGNSENALQLITILKKLCNSPSLLSPKTGDERPSET
ITALLSSLPPNLLRHFTPSCSAKIRVLDQLLHNLRTSTSEKIVLVSNYTSTLNLLANLLN
SLSLPFLRLDGSTPAQKRQALVEDFNRLPPNRCFAFLLSAKAGGTGLNLIGASRLVLFDV
DWNPATDVQAMARIHRDGQKRHCRIYRILLKGSLEEKIWQRQVTKIGLADSVMEHKNSVA
QFSRDELKDLFRLDEASRCQTHELLGCDCGGLGQMAGPSSNDTSIPATDAEDSPSSDLSD
TDHEFPDIPTLIRASQLNMEEQERRFRSQLRGTYRSENHKCKQGNDSAGDEPAKQSRIRQ
SLSHYVHIDPGLLSTATDETVMDLQAALDDDDVLLPLLKDEDSRVSFIFKKSSTAEAKGK
MHPSPVVVD
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcaagccattcaaacctcctctgattaggaaacagcccgacttatccgtctcc
gacgcacccccggcaagcggtgccgctgaacatcacgaacctcttgccaagaagcagcgt
ctggacctagaaatcacaactcatagtaaatcactgaaccgatcatacacgccgagccgc
aagcttctacagcaagtgatcaatgcaggcagctcacccagcgagagcacgactagtgat
gattcatatggggacagatactacaacgtgctatggcgaaaaccgtccacaaagaagaac
aagacgtgggacggcgacggcatcgtctctgcccgtgatggatatctctacctacaggac
atatcagggaaggatatgggacgggtgatgcatgggtcccaacttgaagcaggaaccata
ctctcgataggaggcaaagaagttgagattgactcggagatacccaggaaggagtatcta
gccggcaggcctttcattgagagaaaggacgtcactggccccgttacggcaccggcaccg
ccgaagaagacgttcacacacttactcgggaaccgaagcggtacctcgcttctgacaacc
ccatgccagaagaaccagggtgggagaataggcagctcggccctatcaaatctggcatct
agacccagctctacatccaatgcatacaagaggccgctactagaaagcaccgtcgttcct
gcggggcccgttgggaagccagttccacgccatgacccgaaccaacctggagcactggtc
atgaagcgaccggattcagtacccaaggggaagcaaatcgttgacgttgttgttgatccg
attctctccaaacacttgcgacagcaccaacgcgagggcgtccaattcctttacgagtgc
gtcatgggaatgcgatcgttcaacggagaaggcgctatacttgccgatgacatgggtttg
gggaagactttgcaaacgatcacgctgctctggactctgctgaaacagaatccgatccat
gaaagccctccagtgatcaagaaagcactcattgtttgcccagtgacattgatcaacaac
tggaggaaggagtttcgaaaatggctgggcaacgagcgcatcggtgtattcgtctttgat
gataagaggaagcgtttgacggacttcactatgggcagagcctatagcgtcatgatagtg
ggttacgagaagcttagaaccgtccaagaaggcctcgcgaggggtgcgggagtcgacatt
ataatcgccgacgagggccacagactgaagacgctccagaataagagcggccaggctatc
cagtcactgaacgccacaaagagaatcattctttctggcacaccaatccagaatgacctg
aaggaattcttcgcggcggtggacttggtaaatccaggtattttaggaaacttcaaagct
ttcgtcagagaatttgaagggcctatcgtaaagagcaggcagccggaggcaaccaagaag
gagattgagaaaggcgaagctagaaatgaggagctgcgagagctcacttccaagttcatg
ctacgcaggacggttgacatcctggcgaaatatctgccgccgaaaacagaatatgtcttg
ttctgcaacccaacctccacacaagccactatctacaagaatgtgctcgcctctccagta
ttccagtgtgccattggcaattcagaaaacgccctgcagcttatcaccattcttaaaaag
ctctgcaacagcccttcgctgctttcacctaagactggtgacgaaaggcccagcgagaca
atcacagcgcttttatcgtccctgcctccgaatctcttacgccacttcaccccttcatgc
agcgcaaaaatacgtgtactcgatcagttactccataacctacgcacatctacttcagag
aagattgtcctcgtctcgaactacacgtcgacgctgaacttgcttgcaaacctgctcaac
tcgctctctttgcctttcctgagactagatggctcaactccagcgcagaaaaggcaggcc
ctagtcgaagatttcaatcgtctacccccaaatcgttgtttcgcttttctcctctccgca
aaagcaggaggtaccggactaaatttgataggcgcaagccgacttgtcctcttcgacgtg
gactggaacccagccaccgacgtacaagccatggcgcggatccaccgcgacggccaaaag
aggcattgccggatctaccgcatcttgctgaagggaagcctggaggagaaaatttggcaa
cgccaggtaacgaagatcggactggcggacagcgtcatggaacacaaaaacagtgtggct
caattctcaagggatgagctgaaggatctctttcgtctcgacgaggcgagtcgctgtcag
acgcatgagcttctgggctgcgactgcggtggattagggcagatggctggcccatcgagc
aacgacaccagcattccagccacagatgcggaggactcgccgtccagcgatctctcagac
acggaccatgaattcccggacattcccacactcatcagagcgtcccagctcaatatggaa
gagcaagagcggcggttccgttcgcaactgcgtggtacctatcgaagtgaaaaccacaag
tgcaagcaaggaaacgatagcgctggcgacgaaccggctaaacaaagccgaatacggcaa
tctctctcccattacgtgcatatagaccctggtttgttatcaaccgcaacggatgaaaca
gtaatggatttgcaggctgcacttgatgacgacgacgtccttcttcccttactcaaagac
gaggatagcagagtctcgttcattttcaaaaagtctagtactgcagaggcgaaggggaag
atgcacccctcgccggtggttgtagactag

DBGET integrated database retrieval system