KEGG   Aspergillus fumigatus: AFUA_1G15950Help
Entry
AFUA_1G15950      CDS       T01017                                 

Definition
MAP kinase kinase (Pbs2) (EC:2.7.1.-)
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
afm  Aspergillus fumigatus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:afm04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 656 aa AA seqDB search
MSTATVGPGQESVAEVPSAQIDIDDRSDNTTDDDLSPSVTAPPSLTSVPSLRPDRDMTSG
ISASSTHLGQINAARRGAGTPTRPHASMSGAQPGGLNQDILAKMKAFSLSRQGAPPHLPH
AVSTGTIPSSRPSISASPSPVGGPSPPMGGALAGRLPPTARPHGKNWASSPSVPGATAGS
HSPSPKTGSLAAKRMKPGLKLSDATGPATGSGTSSPGDGSSDASGGSAFSKYSEYIDTKA
GTLNFKNKAILHGGGVEFSSGHSFSISLDEVERLDELGKGNYGTVYKVRHSRPHMRKPGM
GLRGIISRPAENSTPDSTSAAKPQDNLSGYIMAMKEIRLELDENKFAQIIMELDILHRCV
SPFIIDFYGAFFQEGAVYMCVEYMDGGSIDKLYKDGVPENILRKVALSTVMGLKTLKDDH
NIIHRDVKPTNILVNSRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGGVQQSG
ATGGGTYSVQSDIWSLGLTIIECAIGRYPYPPETFNNIFSQLHAIVHGDPPTLPEEGYSE
EAHAFVHACLDKNPSKRPSYSTLLRHPWLAPLMQPPTESNGTEATSAAPSAGQPGGPDTS
TATEDEEVAEWVKERIERRQRGHLQEAEKPALHAVALDAVPGSPLLDDPSSLPSLS
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggctacagtgggcccagggcaagaatcggtcgcagaagttccctccgctcaa
atcgatattgacgaccgatccgacaacacaacggacgatgacctttccccctctgttact
gctcctccgtctcttacttcggtgccatccctgcggccggatcgggatatgacatcgggg
ataagtgcttcgtctactcatttgggccaaatcaatgcggctcggcgtggtgcagggaca
ccgacacggccgcacgcctccatgagtggcgcacagccgggcggtttgaatcaggacatc
ctggccaagatgaaggccttctccctctccagacagggtgcccccccccatttacctcat
gctgtctctaccggaacaatcccttcgtccaggccaagcatttccgcttcgccaagtccg
gtaggagggccgtcgcctcccatgggaggtgcacttgccgggcgtcttcccccgacagca
cgccctcatggtaaaaattgggcgtcttcaccctcagtaccgggagctactgcaggttct
cattcgccttcgccaaaaaccggcagcctggccgcaaaaagaatgaaaccagggttgaaa
ctgtcagatgccactggccctgcgactggctctggaaccagctcgcctggcgatggatct
tcggacgcatctggagggtcagcattcagcaaatattcagagtacattgacacgaaggca
gggactcttaatttcaagaacaaggcgattctgcacggtggcggcgtcgaattctcgtcc
ggacatagtttcagcatctcgttagatgaggttgagcgactggatgagctaggtaagggc
aactacggaaccgtctacaaagttcgacatagccggccccatatgcgcaaacctggtatg
gggcttcgcggcatcattagtcgcccagctgagaactcgaccccggatagcacttctgcg
gctaagccccaggacaatctttctggttacattatggcgatgaaggagattcgcttggag
ctggatgaaaacaaatttgcccagatcatcatggagctggatatcttgcaccgttgcgtt
tcgccattcattatcgacttctacggcgctttctttcaggagggtgcggtctatatgtgt
gtggagtatatggacggaggctctatcgataaactctacaaggacggcgtacccgaaaac
attcttcgaaaggtcgcattatccaccgttatgggattgaagaccctcaaagatgatcat
aacatcattcatcgggacgtgaagcctactaatattctcgtcaattcccgaggtcaaatc
aagatttgcgatttcggcgtgagcggcaatttggtcgccagtattgcgaagactaatatt
ggctgccagagttatatggcacctgaacgtattgcaggaggcggcgtccagcagtccggc
gcgactggtggtggaacttatagtgtgcagagcgacatctggagtttgggcctgaccatc
atcgaatgcgctatcggtcgctatccatatcctccggaaacctttaacaacattttcagc
cagttgcatgctatcgtgcatggggatccgccaaccttaccggaggaaggatattcggaa
gaggcgcatgcatttgtccatgcttgcttggacaaaaatcccagcaagcgtccttcgtat
agtaccttactcagacatccctggcttgctcccttgatgcaacccccgacagagtcgaat
ggtaccgaggcaacgtccgccgctccatctgctggccaacctggcgggcccgatacgagt
actgcgactgaggatgaggaggtggcggaatgggtcaaggagcgaattgaacgtcgccaa
cgggggcacctacaagaggcagagaaacctgcattgcatgcagtggccttagatgcagtg
cccggtagccctctgcttgatgatccctcctcgctcccatcactttcttag

DBGET integrated database retrieval system