KEGG   Aspergillus fumigatus: AFUA_1G16780Help
Entry
AFUA_1G16780      CDS       T01017                                 

Definition
protein kinase (Lkh1) (EC:2.7.11.1)
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AFUA_1G16780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 664 aa AA seqDB search
MSTPSTATATHPTHHQQHYAFPHHHAYQPNASFPVTTAAGTARLATAPYPYAAPPSTAPL
PYNQSSKMVQPASTPSAIPPAQSEVGTGTAGPDQSRRKKKPDWGEFYKNGIPKEVIVIDD
TPPPEQSKGKSRTTAAAAPNGGMAQPAGKKRRTGIESAYDLGYYDRPSFSTNPQQYGEES
SAASISTDRTTSLHTTAPTSLGSQGSTGATNGVFYEDANVGQKRKRVTTRRSAREEQKRR
ELETAGDAFLSYIPPPKPPIKAKEVPVPVVRDYGNRHEKYDDDDGHYIVTPDTPLTDRYS
IIKLLGQGTFGKVVEAYDRQRKTRCAVKIIRSIQKYRDASRIELRVLSTLASNDKTNRNK
CIHLRDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQNFARQLFTSVAFLHDLN
LIHTDLKPENILLVSNAYQTFTYNRTIPSSSHAVSRNARQRRVLLDSEIRLIDFGSATFD
DEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALFQTHDNLEHLAMME
AVIGSKIDTKLVKQATQGGRNGTQNQAAKYFNRNKLDYPNEETTRASRKYVRAMKQLTEF
IPTNTTFHRLFLDLLQRIFVYDPKNRITAKEALKHPWFKESLIDDGTEALRIGQQLQRNG
GQRS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaccctcaacggccactgcaacgcatcccacgcaccaccagcaacactacgca
tttcctcatcaccacgcctaccagccaaacgcctcctttcccgtcacaaccgctgcaggg
actgctcgcctagccacagctccctacccgtacgccgcccctccttcgaccgcacccctt
ccttataaccaatcttcgaaaatggtgcagcctgcctccaccccatcagccattccaccg
gctcagagcgaagtcggcacgggcacagccgggccagatcaaagcagaaggaagaagaag
cctgactggggcgagttctacaaaaatggcattcccaaagaggtcattgtgatcgatgac
acgcctcctccagaacagtccaaaggcaagtcccgtaccactgcggcagcagccccgaac
ggcggcatggctcaacctgccggcaagaaaaggcgcactggaattgaatcagcctatgat
ctgggatactacgatcgtccatcattttccaccaatcctcagcaatacggtgaagagtcc
tccgcagcctccatttctacagaccgcacgacttccctacacacaaccgctcccacatcc
ctgggttcacagggcagtacgggggctaccaacggtgtattttatgaagacgccaatgtt
ggccagaagcggaagcgtgtgacaacccgcaggtcagcccgcgaagaacagaaacggcgg
gaattggaaactgccggtgatgcattcctgagctacatcccccctcccaagccaccgatc
aaggcgaaggaagtcccagtgcctgttgttcgagattatggaaatcgccatgagaagtat
gacgatgacgacggccactacattgtgacgccagacacgccattgacagaccgatactcg
atcatcaagcttctaggacaaggtacattcggtaaagtggttgaggcgtatgacaggcag
cgcaagactcgctgcgcagtcaagatcattcggtcaatacaaaaataccgtgacgcgtcc
agaattgaacttcgggttctgtcaacgttggcctcgaatgataagacgaaccgaaacaag
tgcattcacctacgtgattgcttcgatttccgaaaccatatctgcattgtcacagatctt
ttgggccagagtgtctttgatttcctcaaaggcaacggctttgtgccctttcccagtagt
cagattcagaacttcgctcggcagctattcaccagcgtagccttccttcatgacctaaac
ctcatccataccgatctgaaacccgagaacatcctcctcgtcagcaacgcataccagaca
ttcacctacaaccgaacaattccatcctcttcacacgcagtttcgcggaatgcccgtcag
cgacgtgtgctgttggacagcgaaatccgtctcatcgatttcgggtcggccacttttgat
gatgagtaccactcgtcggtggtatccacgagacattatcgtgctcccgaaattattttg
aatctgggctggagtttcccctgtgatatctggagtatcggttgcattctggttgagttc
ttcacgggggatgcccttttccagacgcacgacaacctagaacacctggccatgatggag
gcggttattggctctaaaatcgatacaaagttggtcaagcaagcgacccagggaggtcga
aacggaactcagaaccaggcggccaaatacttcaaccgaaacaagctggattatcctaat
gaggaaactacacgagcctcgcgcaagtatgtgagagctatgaagcagcttactgaattc
attccaaccaacactacattccatcgcttgttccttgaccttctgcagcggatatttgtc
tacgatcccaagaaccgtatcactgccaaagaggctctgaagcacccgtggttcaaggag
tctttaattgatgatggcaccgaggctcttcgcatcggtcagcagttgcaacgcaacggc
ggtcaacgcagctag

DBGET integrated database retrieval system