KEGG   Aspergillus fumigatus: AFUA_1G17430Help
Entry
AFUA_1G17430      CDS       T01017                                 

Definition
tyrosinase (EC:1.10.3.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
afm  Aspergillus fumigatus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFUA_1G17430
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AFUA_1G17430
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AFUA_1G17430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 616 aa AA seqDB search
MSSNKPYVIKGIPVDAGQIIPVRRDIDEWYEDTSRQSRIQLSIFIWALREFQSIDYKDRL
SYFQIAGIHHFPLITWDEEEPPVPNKPGYCVHNNVTFPTWHRPYMLLFEQRLFEIMETTI
KETVPESHKQEWRDAARQWRLPYWDFAKTSGPHATGPLSLPVLCGLANVVILNPANPETP
IELPNPVYKYRAPDLMGNLDKPFHIPPERIDPDKDDYYPWDKCQATTKYGLLKNNPHIQD
AGQDVTKSNLALNEHPWYRPNKAGFPPLQTLTYEVHRLLSFKFSSWGAFASTKWCNEENK
PPASQQTRDILSLEYIHNNVHPDLQGAGHMSSVPVAAFDPIFWLYHNNVDRLTAIWQVLN
QDHWFDEPHPSDAKPDDPLKPFHVSKDKYFTSDDARFWRKYGYDYDIVKKPGTNEDRAPE
EVKMKINQLYGEPISRLHEGQPVEYDYVINVIYDRYALDGIPYTIVFYLHLKDGSYKCLG
GVYTFSTKLSDAQDTERGGCDNCREQKKAGVLASAQIPLTYTLYERQEWHNLGKLLPVKE
TADIIRQHLCWKVVGVNNSILFDSEQPMRGDPATWRSLDVTAAYSEIHYPVDRNYKYIDR
GLPAYHNYLPIHLSPT
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaacaagccgtatgttatcaaaggcatccctgtcgacgccggccagatcatt
ccagttcgtcgggacattgatgagtggtatgaagacaccagccgacagagcagaattcag
ctgtccatctttatatgggcgctacgtgagttccaatccatcgactacaaagatcgactt
tcctacttccaaattgcaggaatacatcacttcccattgatcacttgggacgaggaggaa
cctccggtgccgaataagcctggatactgcgtacacaataacgtgacttttcccacatgg
catcgaccatacatgctcctgtttgaacaacgtttgtttgaaatcatggaaactactatc
aaggaaacggttcccgagtcgcacaagcaggaatggcgagatgccgctcgtcagtggcgt
ctcccttactgggacttcgcaaagaccagcggccctcatgcaactgggcctttgtcactg
ccggttctttgcggattagccaatgtggttatactaaaccctgcaaacccggaaacccct
attgagctccccaaccctgtgtataaatacagggcccccgatcttatggggaatctggac
aaacccttccacatcccgcctgagcgtatagacccagacaaagacgactactatccatgg
gataaatgtcaggcgacgaccaaatacgggcttctgaagaacaacccgcacatacaggac
gccggacaagatgtgacaaagagtaacctagccttgaatgaacatccatggtaccggcca
aacaaggctggctttccacctctgcagacacttacttacgaagtgcaccgactcttgagt
ttcaagttcagcagctggggggcgtttgcgtcaacaaaatggtgcaacgaggaaaacaaa
ccgcccgcatcacagcagacgagagatatcctttcccttgaatatattcataataatgtc
catcccgacttgcagggagctggccacatgagcagtgttcctgtggcagcgttcgacccg
atcttttggctctatcataacaatgtggaccgccttacagctatctggcaggtcttaaat
caagaccactggttcgatgaaccacaccccagcgacgctaaacccgatgatcctctcaaa
ccattccatgtgagcaaagacaagtatttcacatcggatgatgcgcgattctggcgcaaa
tacgggtacgactacgatatagtaaagaaacccggcacgaatgaagaccgcgcccctgaa
gaagttaagatgaagatcaatcagctctacggcgaaccaatatcgaggctccatgagggc
cagcccgtcgaatacgactatgtgatcaatgttatctacgaccgatacgcgcttgatggt
atcccttacacgattgtcttttatctgcacctgaaagatggtagctacaagtgtttaggt
ggtgtctacacctttagtactaagctgagcgacgcccaagacacggagagaggcggctgt
gacaactgccgtgagcaaaagaaggcaggtgtcctcgcgtccgctcagattccgttgacg
tataccctttatgagagacaggagtggcataacctaggaaagctactccccgtgaaagaa
acagctgatattattagacaacacctctgctggaaggtcgtgggggtcaataactcgata
ctgttcgactctgagcaacccatgagaggtgacccagcaacatggcgttcactcgacgtc
actgccgcttatagtgagattcactatcctgtagatcgcaattacaagtacatcgatcgg
ggcttgccagcctatcataactatcttcccatccatctgtccccaacttag

DBGET integrated database retrieval system