KEGG   Aspergillus fumigatus: AFUA_1G17660Help
Entry
AFUA_1G17660      CDS       T01017                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
afm  Aspergillus fumigatus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFUA_1G17660
  Amino acid metabolism
   00340 Histidine metabolism
    AFUA_1G17660
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AFUA_1G17660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 437 aa AA seqDB search
MARRHLKSRADTASNSTAPQVDVGAIVKGVIDDIRANGDTAVRKYSERFDKWSPASFRLS
REEIEASIAACPPQTIEDIEQVQRNVRAFAKAQRDSIKDFEYEIHPGVYLGQKNLPIQTV
GAYIPGGRYPLLASAHMTILTAKEAGVPKVIGCTPPIAGKIPHATIAAMHLAGADEIYVL
GGVQAIAAMALGTETMDKVDFIAGPGNAFVAEAKRQLFGEIGIDLFAGPTEILIVADETA
NPFTVATDILSQAEHGPDSPAVIITTSEAVGRESMRIITELLKNLSTAELAGTSWERFGE
VIVVDSIDEAWKLADEYASEHVQILTKEPRQALRNMNAYGALFLGEKTCVSYGDKVIGTN
HVLPTKKAARFTGGLWVGKYLRTVTYQEVTSRQASGELGRLCGRAARAENFEGHARSGDL
RAYNYLGDQFEWIQRDI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacgtcacctcaagagtcgcgcagataccgcgtccaactcgacagcgccccaa
gtcgacgttggcgccattgtcaagggtgtgatcgacgacattcgcgccaatggagatacg
gcagttcgcaagtactcggagaggtttgacaaatggtcgcctgcctcgttcaggctctcc
cgggaagagattgaggcatccattgcagcctgccctccacagacaatcgaggatattgaa
caggtccagaggaatgtgcgggcctttgcaaaagcgcaacgtgactcgatcaaagatttc
gagtatgaaattcatccaggcgtgtatcttggacagaaaaatctgcctatccagacagtc
ggagcctacatcccaggcggacgataccccctccttgcctccgcccatatgaccattctc
acagccaaagaagctggcgtccccaaggtcattggctgtactcctcctatcgcaggcaag
attcctcatgcaacaattgcagccatgcatctcgctggtgccgacgagatctacgtgctt
ggaggagtccaagccattgcagccatggcgctgggcactgagaccatggacaaggtggat
ttcatcgcggggcctggcaatgcctttgtcgccgaggcgaagaggcagttatttggcgaa
attgggatagatctctttgccgggccaacggagattcttattgtggctgatgaaactgcc
aatccctttacggtggcaacggacattctctcgcaggccgagcatgggcctgattcgccc
gcggtgatcatcaccacgtctgaggccgttggtcgagaatcgatgcggattattaccgag
ctcttgaagaacctgtccaccgctgaactagcgggaacctcgtgggaacggttcggcgag
gtgatcgtcgtggactcgattgacgaagcttggaaactggccgatgaatatgccagcgag
catgtccagatcctcaccaaagagccgcgacaagccctcaggaacatgaatgcctacggt
gctctattccttggagaaaagacttgtgtctcctacggcgataaggtcattggcaccaac
cacgtccttcccaccaagaaagctgcgagatttacgggaggtctgtgggttggaaaatat
cttcgcaccgtgacatatcaagaagtcaccagccgtcaagcaagcggcgaattgggacgg
ctgtgcggaagagcagcacgcgctgagaacttcgagggtcatgcacggtctggcgatctt
cgggcttacaactatctcggtgatcagtttgaatggattcagagagatatctag

DBGET integrated database retrieval system