KEGG   Aspergillus fumigatus: AFUA_2G00640Help
Entry
AFUA_2G00640      CDS       T01017                                 

Definition
beta-N-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
afm  Aspergillus fumigatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_2G00640
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AFUA_2G00640
   00603 Glycosphingolipid biosynthesis - globo series
    AFUA_2G00640
   00604 Glycosphingolipid biosynthesis - ganglio series
    AFUA_2G00640
   00511 Other glycan degradation
    AFUA_2G00640
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFUA_2G00640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 747 aa AA seqDB search
MGLLISRMQGADVTSTTTECNPCVYLFCTASAICSGQFQNMYLNVILCFSLVTAALQTLP
PVDQTTLGPLPGFDVHSVERVVYIKADFASHRDENGLTLIPPSALEFATTFLHDLQEVTA
SQWTLRQVNHFSAKQGIFLDRLGTDCNLTYENGTPTEEGYEVEIRPRRVDIRGSGARGMW
WGTRTMLQKLILADGKPLPGGRIVDAPSVPTRGYMLDAGRKWYSPGFLKDLCTYASFFKM
SEFHYHTSDNYPLNRGHNETWSEVYAQFSLHPESPDLHGIVQRPNETLSRADYEELEQHC
AQRGVTVVPEIEAPGHCLFLTKWKPELALEKKDLLNLSHPDAVPLVKSVWGEFLPWFHTK
EVHIGADEYDSTLADDYINFVNEMAQFIQKESGKRIRIWGTYEPSDTLSISKDVIVQHWQ
YGQSDPVSLANDGYIMINSEDQWAYMSLKNDHMPIFPAPYPYLFNTSRVLNFANIDGWQW
TPALFNPFNVTEQPNKQAVQGAILVAWNDNGPDATTQLEAFYAMRNGIPIVASRAWTGDR
GPRLDESSLSWSAKLLTARAAGQNLDRRFTGGVNHKTDSLFSWTSGKQSGERIHLGYGSK
GMNYTLELDVAGPFVLSSEDCALSLSASGTLAFTSDGWEYPLRSVAENAGFDPGYPGRIW
TNETSSTHEPVQIPLHSQIIIRTDVIGGSRVWVDGSFVGRFEVFVFGGKNQLFSWSQMAF
VAPLEWIQGGLHGLRIAEYDGSYSSSD
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgggattgttgatctccagaatgcaaggagccgatgtaacctcgacaaccacagaatgc
aacccttgtgtatacttattttgcacagcatcagccatttgctcaggacagtttcaaaat
atgtatctaaatgtcattctatgtttcagtctagtgactgctgcactgcagacacttccc
ccagtggatcaaacaacattaggaccgttgccgggctttgatgttcactcagtggagaga
gtcgtctatatcaaggccgattttgcttctcatcgggacgaaaatggattgacactgatt
cctccatctgctttggaattcgcaacgacattccttcatgatctacaggaggtgaccgcc
agccagtggacactccgccaggtcaatcatttcagtgcaaaacaaggcatcttccttgac
cgacttgggacagactgcaatctgacctatgaaaatggcacgccaacagaggaagggtat
gaagtggaaattcgcccgcgacgggtcgatatccggggatctggggcaagagggatgtgg
tggggaacgcggaccatgctgcagaagttgatcctcgctgacgggaaaccgctcccgggt
ggtcgcattgtggacgcaccctctgttccaactcgaggatacatgctcgacgcgggccgt
aaatggtactcgcctggctttctcaaggacctgtgcacgtacgcctcgttcttcaagatg
tccgagttccactatcacaccagcgacaactaccctctcaatcgggggcataatgagaca
tggagcgaggtgtacgcgcagttttcactccaccctgagagtcctgaccttcatggcatc
gtgcagagaccgaatgagacgctgtctcgagcggactatgaggagctagagcagcattgt
gcgcagcgcggagttacggttgttcctgagattgaagcgcccggccattgcctgtttctg
accaaatggaagccagaactggcgttggagaagaaagatctgctgaacctttctcatcca
gacgcggtgccgcttgtcaagtccgtctggggcgaattcctgccatggtttcacacaaag
gaagtgcatatcggggcggatgagtacgactcgacattggcagatgattatatcaacttt
gtcaatgagatggcacaattcatccagaaggagtctggaaaaaggattcgcatatggggt
acttatgaaccatcagatacgctttctatatccaaagatgtgatcgttcaacactggcaa
tacgggcaatcggatcctgtcagcctggcaaatgatgggtacattatgatcaattcggag
gatcagtgggcgtacatgtcgctgaaaaacgaccatatgcccatatttccggccccgtat
ccatacttgttcaatacctcgcgagtgttgaacttcgccaacatcgacgggtggcagtgg
accccagcgctcttcaacccattcaacgtcactgagcaacccaacaaacaggcagtccag
ggcgcaattctagtcgcatggaatgacaacggaccggacgcgacaacacagctggaggcc
ttctacgcgatgcgcaatgggatcccgattgtcgcctctcgagcatggacaggcgatcga
ggcccgcgactggatgaatctagcttgtcttggtctgcgaaactgcttactgcccgtgcg
gctggccagaaccttgacaggagatttactggtggggtcaatcacaagacggactcgctt
ttcagctggacgtccggcaaacaatcaggagaaaggatccacctcgggtacggcagcaag
ggaatgaattatacactagagctcgacgtcgcggggccattcgtgctgtcctccgaggac
tgcgctctaagtctatccgcatctggtactttggcctttacatccgacggatgggagtac
ccgcttcgctctgtcgccgaaaacgccggattcgacccagggtatccgggacggatttgg
acaaacgagacatcctccacgcatgaacccgtccaaatccctctccacagccagatcatt
attcgcacagatgtcattggagggagcagagtctgggttgatgggagttttgtcgggaga
ttcgaagtctttgtctttgggggaaagaaccaactgttttcgtggagccagatggcattt
gtggcgccactagaatggatccaagggggattacatggactgaggattgctgaatatgat
ggcagttatagttcgagtgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system