KEGG   Aspergillus fumigatus: AFUA_2G01520Help
Entry
AFUA_2G01520      CDS       T01017                                 

Definition
protein kinase
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
afm  Aspergillus fumigatus
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AFUA_2G01520
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AFUA_2G01520
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AFUA_2G01520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1314 aa AA seqDB search
MGNLAKSDYNHTPPDQTDFLAPVSFDDFHNSIMAEPSLNHFPMPGTAVSNHTGSPLSGPF
TRNPWADNDEPSFASRSRSNSVRKSEVSHLSSQNSSAESVASRLPASNTAARSRRQSLVQ
NSAAKAPAPRAPRKSIGPGSIAAATSARRQSVSARKASVDTSPADHASLRPHAQNPDSSG
LDKTRLPSNVRNMKAKSLQPPSREPGDHLLTASGLTDHSRSCSTNAVRTPIKNPAGSATT
PASSAKRVSVMAPHATGLGARTISPTDARRMKRISTAPQAPPLPYTPPTKQDTLPVRPRS
CAQSPSSLPRKSVTPSSTRTTPDPSRKSYSSGLSLSSNTSYSSTRNSGSSLQTRFAQNQS
SSRLPTPKPRAEHMGGNNEEVPPVPAIPKAYESPKGDGDFHTYFASRKSSLPLDIGLPKP
KADHDAEPKQAIRGNDKKTTDHPAERAMKTPDAKTPASNFGKKNLQPLKLPPLNLLPLST
PVASKIEALKDREDDGQSYTPSGQAVTKTPSTPMTASKANFSFRDEDDTMGFTHARSSTS
HFVLSTSTVAPLRTASSSSALASFDNNTTGGARTISPYVSYTLPKSSSDFSNLQQKANTS
GDYSPRISQAYKLTGPRPQTQSSAFSSNAETISQLSTPSDPDNNSVPGSSIFNKVTLTGK
RSDSKSQRSTGADLDPAKQMPPPRLPASATWNNLSTVKGSSPTLKPAYVQARRQSSISGT
SVSTMRNQSVSSEQSLALEPSVSNESGESNTASLRPGSSVFSPMHKMINSAKSSTAATPR
QQHESNPDSDILAADEEMRRLASKRKDFETAARNLDELRRKAGPKERVSPAQALKMANLN
IFERGEIIDFKDIYFCGTQNAKKHVGDLNAQAANFGYDDDRGDYNIVIGDHLAYRYEVLD
VLGKGSFGQVVRCIDHKTGALVAVKIIRNKKRFHQQALIEVNLLQKLKEWDPHRRHSVVN
FTQSFYFRGHLCISTELLGMNLYEFIKAHDFKGFSLKLIRRFTKQILGTLTLLHTKKVIH
CDLKPENILLVHPMSSEIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMW
SLGCILAELYSGYPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTV
SSKGRRRRPSSKDLKQVLKCDDDAFLDFISRCLRWDPARRLTPHDALRHEFITGIKPASR
SRSYGMASLSNKRATTLSNPTARPLPEPPGTSLKNGTFIRSRDISGSSPVKATTVGKRHS
TVSGLQPSTPAKRGTTVPSMPGSALPRVAARSISGKPDLATAAAATSLVSNLAE
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atggggaatctggcaaagtcggactataaccatacgcctcctgatcagacggacttcctt
gcccccgtcagctttgatgatttccacaacagcatcatggcagagccgagtctaaatcac
tttccgatgcccggcactgcggtttcaaatcacacaggaagcccgctctctggcccattt
acgcggaatccgtgggcagataacgatgaacccagctttgccagccggtcgagaagtaat
tccgtgcgaaagagtgaggtttcacatttatcgagccagaattcctccgcagaatcggta
gcttcgcgtcttccggcttccaacacggctgcgcggagtcgccggcagagtcttgtccaa
aactccgctgcaaaagcccctgctccgcgcgctccacggaaatccataggtcctggctcc
attgcagctgctacatctgccagacgtcagagcgtgtctgcccggaaggcaagtgtggac
acgtctccagccgaccatgcaagtctccgcccacatgcccagaatcccgattccagcggc
cttgacaagacgaggctcccttccaatgttcgcaacatgaaagccaagtcgctccagcca
ccctcccgggagcctggtgaccatctgctgacagcatctggattgactgaccactcccgg
tcatgttccactaatgctgttcggacgccgattaagaatcctgccggcagtgcgactacg
cccgcttcatctgcgaaaagggtgtcagttatggccccacacgcgacaggcctcggggct
cgaacaataagccctactgatgcacggcgtatgaagcgaatctctacagcgccgcaggcg
cctccattaccatatactcctccaaccaaacaggacacgcttcctgttcgcccgcggtcc
tgcgcccagtctccgtctagtctgccgcggaagagcgtcacaccatcgtcgacgagaaca
acgcccgacccaagtcggaaatcctacagttcaggcttgtctttgtcgtccaacacgagc
tatagctctacgaggaactccggcagttccttgcagacaaggtttgcccagaaccaatca
tcttcccggttacctaccccaaaaccgcgcgcagaacatatggggggaaacaacgaagag
gtccctcctgttcccgcaatccccaaggcttacgagtctcccaagggtgacggcgatttt
catacctactttgcttcgcggaagtctagtcttcccttggatatcggtcttccgaagcct
aaggctgaccacgacgctgagcccaaacaagcgataaggggtaacgacaaaaagactacg
gatcatcctgctgagcgagcaatgaaaactcccgatgccaagactccagcgagcaatttt
gggaagaagaatctgcagcctttgaaattgcccccgttgaacctgttgcctctcagcact
cctgtggcctctaaaatcgaagctttgaaggaccgcgaagacgatgggcaatcctacact
ccttcaggccaggccgtaactaagactccgagcacgccgatgacggcctccaaggcaaat
ttctcctttcgagatgaggatgacacaatgggttttactcacgctcgaagcagcacttcc
catttcgtgctgagcacctcaacagttgctcctctgagaacagcaagtagctccagtgca
ttggcgtcttttgacaataatactactggtggtgcgcgaacaatctccccttatgtctca
tacacattgccaaagagtagcagcgacttcagcaacctacaacaaaaagccaacacaagt
ggcgattattccccacgaatctcgcaagcatacaagttgactgggcctcgacctcaaact
caatcgtccgcattctcttcgaatgctgagacaatcagtcaattgtccactccttcggat
cctgacaacaacagcgttcctgggtcttcaatcttcaataaagtcaccttgaccggaaag
cgtagcgactccaaatcacaacgttcgacaggtgctgatctggacccggcgaagcaaatg
ccgccccctagactcccagcatctgccacttggaataatctgtccacagtcaaaggctca
agtcccacactcaagcccgcgtacgttcaagcaagacgtcagtcatctatttccggcacg
agtgtctcaacaatgcggaaccaaagtgtgagcagtgaacagagtctcgctttggagcca
agtgtctcgaatgagtccggggaaagcaatacggcctcactacgacccggatcatccgtc
ttctcgcccatgcacaagatgatcaattcggctaaatctagcacggcagccacccctcgc
cagcagcatgagtctaaccctgactctgacattttggcagccgatgaggagatgcgcaga
ctcgctagcaagcgcaaggactttgagactgccgccaggaatctagacgaattacgtcgc
aaggcaggcccgaaggagcgagtaagcccagcgcaggcactgaaaatggccaatctcaat
atctttgaacgtggagagatcatcgacttcaaggatatctacttctgcggaacgcagaat
gcgaagaaacatgttggtgatctgaatgcgcaagctgccaacttcggctacgacgatgat
cgtggtgactacaacatcgtgatcggtgatcatcttgcgtatcggtatgaagtgctcgat
gttctgggcaaaggtagctttggtcaggttgtgagatgcattgaccacaagacgggagct
ctggttgctgtgaagatcattcgcaacaagaaacggttccaccaacaagctctgatcgag
gtgaacctcctccagaaactcaaggagtgggatccgcatcgccgtcacagcgtggttaat
ttcacacagagcttctattttaggggacatctctgtatttccacggaactgctcggaatg
aacctttatgaatttatcaaggctcacgacttcaaagggttttcactcaaacttatacgc
cgcttcacgaagcagatcctgggcactctgacactcctgcacaccaagaaggttattcat
tgtgacctcaaacccgagaatatccttctcgttcatcccatgagctccgaaatccgggtc
atcgattttgggtccagttgtttcgagaatgagaaagtgtatacctatatccaaagtcgt
ttttaccgctcgccagaggtcattcttggcatgtcttacggcatgccgattgatatgtgg
agtctggggtgtatcttggcggagctctacagcgggtatcccattttcccgggagaaaat
gaacaggagcagcttgcttgtataatggaggtgtttggtcctcccgagaaacatttaatt
gagaagagcactcggaagaagttattctttgattctttgggcaagcctagactcaccgtc
tcttcaaagggcagaaggcgtcggccaagttcaaaggacctcaaacaggttttgaagtgt
gacgatgatgcgttccttgactttatctctcgctgtcttcgatgggatcctgctcgtcgg
ctcacccctcacgatgcgctccgacatgagtttataactggaatcaaacctgcgtcacgc
tctcgaagctatggtatggcgagcctctcaaacaagcgtgccactactctgtctaatcca
acagcacggccgctgccggagccacctggaactagtctcaaaaacggtacatttattcgc
agtcgcgacatttcaggcagctctcctgtgaaagcgacaacagttggtaaacggcactcc
accgtgagcggcctgcagccgtcaactcctgccaagcgaggcacaactgtcccttctatg
cctggttcagcattgccccgtgtcgcagccagaagtatcagtggaaagcccgacctcgcg
actgcggcggcagcgacgagtctagtaagtaatctggccgagtaa

DBGET integrated database retrieval system