KEGG   Aspergillus fumigatus: AFUA_2G02400Help
Entry
AFUA_2G02400      CDS       T01017                                 

Definition
hypothetical protein
Orthology
K14526  
ribonuclease P/MRP protein subunit POP7 [EC:3.1.26.5]
Organism
afm  Aspergillus fumigatus
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:afm03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:afm03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 240 aa AA seqDB search
MAKQPLVKTLQFEKKNKDMLKLPKYARVQKRPIPHAPVASPYAGASVPKIVYVSTKSPFM
SAVKRVQKLLRQAEKRATAAVNLSSSKTTDRQKLAEVARGQEQLSEEAVFVKATGRAIEK
ALSVGRWFEERGNEYAVRVKTGSVLVVDDIEEDEEAKRKAIVEAERVLQQEQAQKKKEDE
KDDGQPAADQSVDAPAQPVSKSETKKRKRAANVLASASSEELPETRTRWVNMVEIAVTLK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacaacctctcgtcaaaaccctccagttcgagaaaaagaacaaagacatgctc
aagctcccaaaatacgctcgcgtccaaaaacgccctattccacatgcccccgtcgcatcc
ccctacgccggcgcctcggtcccgaaaatcgtctacgtctccaccaagtcccccttcatg
agcgccgtcaaacgcgtccagaagcttctccgacaggctgaaaaacgcgccacggcggcg
gtcaatctctcaagtagcaagacgacagatcggcagaagctggctgaggtagcgcgtgga
caggagcagctgagtgaggaggcggtgtttgtcaaggccacgggccgggcgatcgagaag
gcgctaagcgttgggcggtggttcgaggagcgggggaatgagtatgccgtgcgggtgaag
acggggagtgtgctcgtcgtggatgatattgaggaagacgaggaggcgaagcggaaggcg
attgtggaggcggagagggttctgcagcaggaacaggcgcagaagaagaaggaagacgag
aaagatgatggtcagccagccgcggatcagtctgtcgacgctcccgcgcagcctgtatcg
aaatcagaaacgaagaagaggaaacgcgctgcgaatgttctggcctcagcctccagtgag
gagttgccggagacacgaacgcgatgggtcaacatggtggagatcgccgtgacgcttaag
tga

DBGET integrated database retrieval system