KEGG   Aspergillus fumigatus: AFUA_2G02400Help
Entry
AFUA_2G02400      CDS       T01017                                 

Definition
hypothetical protein
Orthology
K14526  
ribonuclease P/MRP protein subunit POP7 [EC:3.1.26.5]
Organism
afm  Aspergillus fumigatus
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_2G02400
   03008 Ribosome biogenesis in eukaryotes
    AFUA_2G02400
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     AFUA_2G02400
Ribosome biogenesis [BR:afm03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     AFUA_2G02400
Transfer RNA biogenesis [BR:afm03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    AFUA_2G02400
Mitochondrial biogenesis [BR:afm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    AFUA_2G02400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 240 aa AA seqDB search
MAKQPLVKTLQFEKKNKDMLKLPKYARVQKRPIPHAPVASPYAGASVPKIVYVSTKSPFM
SAVKRVQKLLRQAEKRATAAVNLSSSKTTDRQKLAEVARGQEQLSEEAVFVKATGRAIEK
ALSVGRWFEERGNEYAVRVKTGSVLVVDDIEEDEEAKRKAIVEAERVLQQEQAQKKKEDE
KDDGQPAADQSVDAPAQPVSKSETKKRKRAANVLASASSEELPETRTRWVNMVEIAVTLK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacaacctctcgtcaaaaccctccagttcgagaaaaagaacaaagacatgctc
aagctcccaaaatacgctcgcgtccaaaaacgccctattccacatgcccccgtcgcatcc
ccctacgccggcgcctcggtcccgaaaatcgtctacgtctccaccaagtcccccttcatg
agcgccgtcaaacgcgtccagaagcttctccgacaggctgaaaaacgcgccacggcggcg
gtcaatctctcaagtagcaagacgacagatcggcagaagctggctgaggtagcgcgtgga
caggagcagctgagtgaggaggcggtgtttgtcaaggccacgggccgggcgatcgagaag
gcgctaagcgttgggcggtggttcgaggagcgggggaatgagtatgccgtgcgggtgaag
acggggagtgtgctcgtcgtggatgatattgaggaagacgaggaggcgaagcggaaggcg
attgtggaggcggagagggttctgcagcaggaacaggcgcagaagaagaaggaagacgag
aaagatgatggtcagccagccgcggatcagtctgtcgacgctcccgcgcagcctgtatcg
aaatcagaaacgaagaagaggaaacgcgctgcgaatgttctggcctcagcctccagtgag
gagttgccggagacacgaacgcgatgggtcaacatggtggagatcgccgtgacgcttaag
tga

DBGET integrated database retrieval system