KEGG   Aspergillus fumigatus: AFUA_2G02510Help
Entry
AFUA_2G02510      CDS       T01017                                 

Definition
TORC1 growth control complex subunit Kog1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1435 aa AA seqDB search
MRDPTINMEQDIAAKPQATSLQVEPRKNQKSVRVAFGPDLDTYIPPRDKSPAPSSGHHRS
YTTVEHSQPSISSLHRPASSSAGDNAAAFEPSPRLTSDRASDSGGRPTAALKRARSDYGP
RLGFDKSAVADEEEDFAMRHGWQEEYTSSEYLKVLHSNFYMYFTEKRHDTNGIPRDPVGS
WPSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSTTGGGQNKIME
QIGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQ
SGEIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHIFVEKHEKENLEA
KKRDPNAVVQNYGDCILLAACQKNESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQ
TNLSIDEFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFR
NFLLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLSQLPALIDHEEGRRQYEY
QHSTFFAEQLTAFEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWA
VHLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILN
PSSPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSGELFDSCLKHLTDVENPLLRQWS
CLCISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAATTFLGIPDLTDQVA
QIEESLALAVLPMASDGSVLVRKELLVFFSTFVKRYQNKFLVAAYEEFQDEKQTLLLRLE
HDGSRGFTMEDVQNGTANSRNKSQKLSQNTAFGTIWKQLLILSVDPHPDIAQDASTIIDY
IHLTLLASPMASLTDKARKEIMELTSRLSQKLQVRERAESKKAAPPPAPPSQTAAPKQEG
YLSLSIKRTASVAASLKNLAFGGPPQNEQQSSQNVTSPTKSRTPVTPRGRAPPEWTRPPE
VNDQVASAAAYHQAPIPPSRGFEPRDPSLAPMIPLLSRFLDWSTEYFREPQMKPNEPDEP
GSADYNERLWRRGRNEKIITETQPLKGKAGSSRWDNSLALLTNTSQPLKMCFHQFEDHLA
VADDRDTIAIWDWQRHKRLNRFSNGNPPGSRINEVRYINEDDQALLMTGSSDGVLKVFRN
YESPKEVEIVTAFRALPELIPSNRNAGLVFDWQQGQGKALVAGDVKVIRVWNAATEVCTN
DIPARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTSMVKVWREHKQWITNVH
MQRGGLRELVSGSRNGEIRLWDLRMDGPISTIYATKDTLRTLSVHEHAPVFMVGTNRHEV
KTFNMDGTYLSTFEPYSSFLHHNRSSPIASTAFHPHRTILACAALNDNHINLVSC
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atgagggatcccaccatcaacatggagcaagacattgcagcgaaaccgcaggcgacaagc
cttcaagttgaaccacgcaagaatcaaaagtccgtccgtgtcgctttcggtccggatttg
gacacttatattcctccgcgcgataagtcacccgcgccgtcctcaggccaccacagatct
tacaccactgttgaacattcgcaaccatctatatcgtcgcttcaccgtccagccagttca
tcagcaggagataatgcggcagccttcgagccgagtcctcggttgacgtcagatcgagct
tcagactccggcggaagaccgacagcagctctgaaaagggctcgaagtgactatggaccg
agattgggattcgacaagtctgctgttgccgatgaggaagaagactttgccatgcgacat
gggtggcaggaggagtacacctcaagcgagtaccttaaggttctacactcgaacttttac
atgtacttcacagagaagcggcacgatacgaacggcatcccaagagacccagttggaagc
tggcccagtcaggattggcgcatgaaggatcgtttgaagacagtttcggctgccctcgcc
atctgcttgaacatcggtgtcgaccctcctgacgtggtgaagacgaacccatcagccaag
ttggaatgctgggtggatcctacatcgaccacgggcggtggccagaacaagataatggag
cagattggaaagaagttgcaggagcagtacgaaactctcagcttaagaactagatacaag
cagtatcttgacccttcagttgatgagacgaaaaagttctgcatttctctgcgccgtaac
gctaaggatgagagggttctctttcactacaacggtcacggtgttccgttgcctacacaa
tcgggagaaatctgggtgtttaacaagaactatacccagtacattccagttagtttgtat
gatttgcaatcctggctcgctggtcccagtctcttcgtttttgatgtttcccacgcaggg
aacatcgtgcagaatttccacatttttgtggagaagcacgaaaaggagaaccttgaagcc
aaaaagcgtgatccaaatgccgtggttcagaactacggggattgcatccttctggcagct
tgtcagaagaacgagtcactacctaccaatcccgacctccccgcagaccttttcacctgc
tgcctgaccacaccgatagagatagcactgcgctacttcattctccagaatcccctccag
acaaatctctcaattgacgaattcagagtccctggtcgtttgcaggaccgcagaagccct
ctcggcgagttgaactggatcttcaccgcaatcactgacaccattgcatggaacacattg
ccacgggcattgttcaagaagcttttccgacaagatttgatggtggctgcacttttcagg
aactttcttctcagcgagcgcatcatgcgcacgtacaagtgtcacccgatatcctcaccc
gaactcccagagactcatcatcatccgctttggaaaagctgggatcttgctgttgagatg
gtgctatctcagctaccagctctcattgaccatgaagaaggccgcagacaatacgagtac
caacattccacttttttcgcggaacaactcactgcttttgaggtctacctctcatccggt
ccaaccgagaagaacccgccggatcaactccctatcgttctgcaagttctacttagccag
gcacatcgactaagggccctcatcctcttgagtaagtttcttgacttgggaccgtgggct
gttcatctcgctctgagcatcggtattttcccgtatgttgtcaaactgctacaatcagca
gcccaagagctgaaacctgtcatggtgttcatttgggcacggattatggcagtggatcac
accgttcagaacgatctgctgaaggacaatggcatccattatttcatctctatccttaac
ccttcatcacccattcctgtgggtaacgcgagtgagcaccgagcaatgtgtgcctttatt
gtttcgatattttgtaagaactatcctcagggacagaatgtgtgcctttctggcgagctt
tttgactcttgtctgaagcatctgactgatgtggaaaatcctttactccgacaatggtca
tgtctctgcatcagcatgctctggtccgactttcccgaagccaagtggatgggaatccgg
tgtgctgcacccgcaagactctgtgagctcaatttcgaccccgttccggaggtcagggca
gcgatgctccatgcagcgaccacattcttaggcattcctgatttgaccgatcaggtggca
cagattgaagaatccctggcattggctgtgctgcccatggcatcagacggtagtgtcctg
gtgagaaaggagctccttgtcttcttctcgacctttgtcaaacgctaccagaacaaattc
ctggtcgccgcatacgaagagttccaggacgagaagcaaacccttctccttcggttagag
cacgacggctctcgaggcttcacaatggaagatgtgcagaatggaactgcaaactcacgc
aacaaatcacagaaattgtcgcagaataccgcgttcggcacgatctggaaacaacttctt
atactctctgttgacccacaccctgatattgcgcaagacgctagcacgattattgactac
atccacctcacccttctagcgtctcccatggcgtcgcttactgacaaggcccgaaaggaa
attatggaactcactagccggttgtcacagaaattacaagttcgcgagagagcggaatcg
aaaaaggccgcgcctccaccagctcctccttcccagacggctgctcccaaacaggaagga
tacttgtcattgagtatcaaaagaacagccagtgtggccgcttcactcaagaaccttgct
ttcggtggaccccctcagaacgagcaacaatcatcgcagaacgtaacatcgcccacaaag
agccgcactcccgtcacccctcgaggacgtgccccccccgaatggacccggcctccggaa
gtcaacgaccaggtcgcttccgcggccgcttatcaccaggctccaattcctccctcgcgc
ggttttgaaccccgagacccatctctagcccccatgataccccttctgagtcggtttctt
gattggtccacagagtatttccgtgagccccagatgaagcccaacgagcccgacgaaccc
ggtagcgccgactacaacgagcgcctctggagacgtggccgcaacgagaagatcatcacg
gaaacccagcctctcaagggaaaagcaggcagcagtcgctgggataactctttggccctg
cttactaataccagtcagcccctgaagatgtgtttccatcaatttgaggatcacctcgca
gttgcggatgaccgggacacgatcgcaatttgggactggcagagacacaagcgtcttaat
aggttttccaacgggaacccgccgggctcaaggatcaacgaagttcgctatatcaacgag
gacgatcaagcgctgctgatgaccgggtcctccgacggggtactcaaagtattcagaaat
tacgaatccccgaaagaggtggagatagtgacagctttccgtgctttgccggaactaatc
ccaagcaatagaaatgccggtcttgttttcgattggcagcaaggccaaggcaaagcattg
gttgctggggatgtgaaggtgatccgtgtgtggaacgcggccactgaagtctgcaccaac
gacatccccgctcgctcagggtcttgcattacctccctgacttccgaccaggtggcaggg
aacatctttgtggccggattcggcgacggtgcagtccgcgtctttgatcaacgtctaaaa
cctacaacctcgatggtgaaggtttggcgtgagcacaagcaatggatcaccaacgtccac
atgcaacggggtgggttgagggagctcgtgtccggcagtcgaaatggcgagatcagattg
tgggatcttcgcatggatggcccgatctcaacaatttatgccaccaaagataccctcagg
acgttgagtgttcacgagcacgctcccgtattcatggtcggcacgaatcgccatgaggtc
aagacattcaacatggatggaacatatctgtccacgttcgaaccatactctagcttcctg
caccacaaccgctcttcccccattgccagcactgccttccacccacatcgtaccattctt
gcctgcgccgcgcttaatgataaccacatcaaccttgtgagttgctag

DBGET integrated database retrieval system