KEGG   Aspergillus fumigatus: AFUA_2G02510Help
Entry
AFUA_2G02510      CDS       T01017                                 

Definition
TORC1 growth control complex subunit Kog1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
afm  Aspergillus fumigatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1435 aa AA seqDB search
MRDPTINMEQDIAAKPQATSLQVEPRKNQKSVRVAFGPDLDTYIPPRDKSPAPSSGHHRS
YTTVEHSQPSISSLHRPASSSAGDNAAAFEPSPRLTSDRASDSGGRPTAALKRARSDYGP
RLGFDKSAVADEEEDFAMRHGWQEEYTSSEYLKVLHSNFYMYFTEKRHDTNGIPRDPVGS
WPSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSTTGGGQNKIME
QIGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQ
SGEIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHIFVEKHEKENLEA
KKRDPNAVVQNYGDCILLAACQKNESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQ
TNLSIDEFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFR
NFLLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLSQLPALIDHEEGRRQYEY
QHSTFFAEQLTAFEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWA
VHLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILN
PSSPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSGELFDSCLKHLTDVENPLLRQWS
CLCISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAATTFLGIPDLTDQVA
QIEESLALAVLPMASDGSVLVRKELLVFFSTFVKRYQNKFLVAAYEEFQDEKQTLLLRLE
HDGSRGFTMEDVQNGTANSRNKSQKLSQNTAFGTIWKQLLILSVDPHPDIAQDASTIIDY
IHLTLLASPMASLTDKARKEIMELTSRLSQKLQVRERAESKKAAPPPAPPSQTAAPKQEG
YLSLSIKRTASVAASLKNLAFGGPPQNEQQSSQNVTSPTKSRTPVTPRGRAPPEWTRPPE
VNDQVASAAAYHQAPIPPSRGFEPRDPSLAPMIPLLSRFLDWSTEYFREPQMKPNEPDEP
GSADYNERLWRRGRNEKIITETQPLKGKAGSSRWDNSLALLTNTSQPLKMCFHQFEDHLA
VADDRDTIAIWDWQRHKRLNRFSNGNPPGSRINEVRYINEDDQALLMTGSSDGVLKVFRN
YESPKEVEIVTAFRALPELIPSNRNAGLVFDWQQGQGKALVAGDVKVIRVWNAATEVCTN
DIPARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTSMVKVWREHKQWITNVH
MQRGGLRELVSGSRNGEIRLWDLRMDGPISTIYATKDTLRTLSVHEHAPVFMVGTNRHEV
KTFNMDGTYLSTFEPYSSFLHHNRSSPIASTAFHPHRTILACAALNDNHINLVSC
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atgagggatcccaccatcaacatggagcaagacattgcagcgaaaccgcaggcgacaagc
cttcaagttgaaccacgcaagaatcaaaagtccgtccgtgtcgctttcggtccggatttg
gacacttatattcctccgcgcgataagtcacccgcgccgtcctcaggccaccacagatct
tacaccactgttgaacattcgcaaccatctatatcgtcgcttcaccgtccagccagttca
tcagcaggagataatgcggcagccttcgagccgagtcctcggttgacgtcagatcgagct
tcagactccggcggaagaccgacagcagctctgaaaagggctcgaagtgactatggaccg
agattgggattcgacaagtctgctgttgccgatgaggaagaagactttgccatgcgacat
gggtggcaggaggagtacacctcaagcgagtaccttaaggttctacactcgaacttttac
atgtacttcacagagaagcggcacgatacgaacggcatcccaagagacccagttggaagc
tggcccagtcaggattggcgcatgaaggatcgtttgaagacagtttcggctgccctcgcc
atctgcttgaacatcggtgtcgaccctcctgacgtggtgaagacgaacccatcagccaag
ttggaatgctgggtggatcctacatcgaccacgggcggtggccagaacaagataatggag
cagattggaaagaagttgcaggagcagtacgaaactctcagcttaagaactagatacaag
cagtatcttgacccttcagttgatgagacgaaaaagttctgcatttctctgcgccgtaac
gctaaggatgagagggttctctttcactacaacggtcacggtgttccgttgcctacacaa
tcgggagaaatctgggtgtttaacaagaactatacccagtacattccagttagtttgtat
gatttgcaatcctggctcgctggtcccagtctcttcgtttttgatgtttcccacgcaggg
aacatcgtgcagaatttccacatttttgtggagaagcacgaaaaggagaaccttgaagcc
aaaaagcgtgatccaaatgccgtggttcagaactacggggattgcatccttctggcagct
tgtcagaagaacgagtcactacctaccaatcccgacctccccgcagaccttttcacctgc
tgcctgaccacaccgatagagatagcactgcgctacttcattctccagaatcccctccag
acaaatctctcaattgacgaattcagagtccctggtcgtttgcaggaccgcagaagccct
ctcggcgagttgaactggatcttcaccgcaatcactgacaccattgcatggaacacattg
ccacgggcattgttcaagaagcttttccgacaagatttgatggtggctgcacttttcagg
aactttcttctcagcgagcgcatcatgcgcacgtacaagtgtcacccgatatcctcaccc
gaactcccagagactcatcatcatccgctttggaaaagctgggatcttgctgttgagatg
gtgctatctcagctaccagctctcattgaccatgaagaaggccgcagacaatacgagtac
caacattccacttttttcgcggaacaactcactgcttttgaggtctacctctcatccggt
ccaaccgagaagaacccgccggatcaactccctatcgttctgcaagttctacttagccag
gcacatcgactaagggccctcatcctcttgagtaagtttcttgacttgggaccgtgggct
gttcatctcgctctgagcatcggtattttcccgtatgttgtcaaactgctacaatcagca
gcccaagagctgaaacctgtcatggtgttcatttgggcacggattatggcagtggatcac
accgttcagaacgatctgctgaaggacaatggcatccattatttcatctctatccttaac
ccttcatcacccattcctgtgggtaacgcgagtgagcaccgagcaatgtgtgcctttatt
gtttcgatattttgtaagaactatcctcagggacagaatgtgtgcctttctggcgagctt
tttgactcttgtctgaagcatctgactgatgtggaaaatcctttactccgacaatggtca
tgtctctgcatcagcatgctctggtccgactttcccgaagccaagtggatgggaatccgg
tgtgctgcacccgcaagactctgtgagctcaatttcgaccccgttccggaggtcagggca
gcgatgctccatgcagcgaccacattcttaggcattcctgatttgaccgatcaggtggca
cagattgaagaatccctggcattggctgtgctgcccatggcatcagacggtagtgtcctg
gtgagaaaggagctccttgtcttcttctcgacctttgtcaaacgctaccagaacaaattc
ctggtcgccgcatacgaagagttccaggacgagaagcaaacccttctccttcggttagag
cacgacggctctcgaggcttcacaatggaagatgtgcagaatggaactgcaaactcacgc
aacaaatcacagaaattgtcgcagaataccgcgttcggcacgatctggaaacaacttctt
atactctctgttgacccacaccctgatattgcgcaagacgctagcacgattattgactac
atccacctcacccttctagcgtctcccatggcgtcgcttactgacaaggcccgaaaggaa
attatggaactcactagccggttgtcacagaaattacaagttcgcgagagagcggaatcg
aaaaaggccgcgcctccaccagctcctccttcccagacggctgctcccaaacaggaagga
tacttgtcattgagtatcaaaagaacagccagtgtggccgcttcactcaagaaccttgct
ttcggtggaccccctcagaacgagcaacaatcatcgcagaacgtaacatcgcccacaaag
agccgcactcccgtcacccctcgaggacgtgccccccccgaatggacccggcctccggaa
gtcaacgaccaggtcgcttccgcggccgcttatcaccaggctccaattcctccctcgcgc
ggttttgaaccccgagacccatctctagcccccatgataccccttctgagtcggtttctt
gattggtccacagagtatttccgtgagccccagatgaagcccaacgagcccgacgaaccc
ggtagcgccgactacaacgagcgcctctggagacgtggccgcaacgagaagatcatcacg
gaaacccagcctctcaagggaaaagcaggcagcagtcgctgggataactctttggccctg
cttactaataccagtcagcccctgaagatgtgtttccatcaatttgaggatcacctcgca
gttgcggatgaccgggacacgatcgcaatttgggactggcagagacacaagcgtcttaat
aggttttccaacgggaacccgccgggctcaaggatcaacgaagttcgctatatcaacgag
gacgatcaagcgctgctgatgaccgggtcctccgacggggtactcaaagtattcagaaat
tacgaatccccgaaagaggtggagatagtgacagctttccgtgctttgccggaactaatc
ccaagcaatagaaatgccggtcttgttttcgattggcagcaaggccaaggcaaagcattg
gttgctggggatgtgaaggtgatccgtgtgtggaacgcggccactgaagtctgcaccaac
gacatccccgctcgctcagggtcttgcattacctccctgacttccgaccaggtggcaggg
aacatctttgtggccggattcggcgacggtgcagtccgcgtctttgatcaacgtctaaaa
cctacaacctcgatggtgaaggtttggcgtgagcacaagcaatggatcaccaacgtccac
atgcaacggggtgggttgagggagctcgtgtccggcagtcgaaatggcgagatcagattg
tgggatcttcgcatggatggcccgatctcaacaatttatgccaccaaagataccctcagg
acgttgagtgttcacgagcacgctcccgtattcatggtcggcacgaatcgccatgaggtc
aagacattcaacatggatggaacatatctgtccacgttcgaaccatactctagcttcctg
caccacaaccgctcttcccccattgccagcactgccttccacccacatcgtaccattctt
gcctgcgccgcgcttaatgataaccacatcaaccttgtgagttgctag

DBGET integrated database retrieval system