KEGG   Aspergillus fumigatus: AFUA_2G03110Help
Entry
AFUA_2G03110      CDS       T01017                                 

Definition
alkaline phosphatase Pho8 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
afm  Aspergillus fumigatus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afm00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 607 aa AA seqDB search
MARDEPLLAPRPSSENNSIRNAEEEDALLTGERTGRGQERRGWTFWREVGLFSWALLATI
AVIVLAVVYQHETSNPNGGSRPPWGPGGKPTGKRNLIFMVSDGMGPTSLTMTRSYRQFVE
GLPIDDILVLDGHIIGTSRTRSSSSLVTDSAAGATAFSCGFKSYNGAISVLPDHSPCGTV
LEAASLAGYKTGLVVTTRITDATPACFASHVNLRQYEDRIAEQEIGEHPLGRVVDLIFGG
GRCHFLPNSTEGSCRADDRDLVSVAKKRGFSYLDDRKGFDSLNGGSEAKLPLLGLFAEKD
IPFEIDRRNQNDVYPSLEEMARTALKILSDATADSEQGFFLMIEGSRIDHAGHGNDPAAQ
VHEVIAYDKAFAAVLDFLGKDSTPGVVVSTSDHETGGLAAARQLHTSYPEYKWLPGVLAN
ASHSTEYIDNKLREFLSTETEKNKQQHYVRELLEKGLGITDATDEEIDSILDPNSPVSSQ
YQLADMISRRAQIGWSTHGHSGVDVNIYASSSKDAWPLVGNHENTEIGQFISDYLDLDVE
NITKHLQSSSAWSFAGGDVERPFAWLGNPLGADVRTEGFDTYHGEFRKRSMDVDGMEKRE
CGCGGMH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagacgagcctcttttggctccgcgcccatcttcggagaacaactccattcgg
aatgcggaagaggaggacgcactgttgaccggggagcggactgggcgtggccaggagcga
cggggttggactttctggcgagaagtcggtctcttcagctgggcgctcctagctacaatt
gctgttatcgtgctcgcagtcgtctaccagcatgaaacgagcaacccgaacggtggctcg
agacccccctggggtcccggagggaagccgaccggcaagcgcaacctaatcttcatggtg
tcggacggaatgggccctaccagtcttaccatgaccagaagctatagacagttcgtggag
ggattgccgattgacgacattttggtgctggatggccacatcattggaacttccaggacg
aggtcgagttccagtctggtaacggattcggcggccggtgcaacggctttctcttgcggt
ttcaagagttacaatggtgccatctctgtgcttccggatcattcgccctgtggaaccgtc
ctcgaggctgcgtcgttggccggttacaagaccggacttgttgtaacgactcggatcacc
gatgccacccctgcttgttttgcgtcgcacgtgaacttgcggcaatacgaagatcggatt
gccgagcaggaaattggcgagcacccactcgggcgcgtggtcgatcttatctttggtggt
ggtcgttgccatttcctgcccaattcgactgaggggagctgccgggcagacgatcgcgac
ttggtcagtgtcgcaaagaagaggggattcagctaccttgatgataggaagggctttgac
tcgctgaatggcggatcggaggccaagctgcccctcctgggtctgtttgcggagaaggac
attccgtttgagattgaccgtcgtaatcagaacgacgtttacccgtccctggaagagatg
gcccgcaccgcactcaagatactcagcgatgctaccgctgatagcgagcaggggtttttc
ttgatgatcgaaggttctcgtattgatcatgccgggcacggcaatgatcccgcagcgcag
gtccacgaggttattgcgtacgataaggcattcgctgcagtgctggacttccttgggaaa
gactcgacgcccggtgttgtggttagcacatctgaccatgaaacgggtggcctggcggcc
gctcggcagctgcatacctcctacccggagtacaagtggcttcccggggttctggccaac
gccagccattccaccgaatacattgacaacaagcttcgggagtttctctccacggagacg
gaaaagaacaagcagcaacattatgtccgagagctcttggagaagggtctaggtattacc
gatgccacagacgaggagatcgattctattctcgatccaaattcgccagtaagctcgcag
tatcagcttgcggacatgatcagtcgaagagcccagatcggctggtcaacccatggccac
tctggtgttgacgtcaacatctatgcatcctcttctaaagatgcctggcccctggttggg
aaccacgaaaataccgagatcggccagttcatttcagactaccttgacctggacgtggag
aacatcaccaagcacctacaatcatccagcgcctggtcgttcgccggcggtgacgtagag
cggcccttcgcctggctaggaaatcctttgggcgcggatgtccgcaccgagggctttgat
acctaccacggagagttcaggaaacgctctatggacgtggacggcatggagaagagggag
tgcgggtgcggagggatgcattga

DBGET integrated database retrieval system