KEGG   Aspergillus fumigatus: AFUA_2G03390Help
Entry
AFUA_2G03390      CDS       T01017                                 

Definition
histone deacetylase RpdA/Rpd3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 688 aa AA seqDB search
MAAPPIDLNLNGSGDRSRKVAYFYDSDVGNYAYVSGHPMKPHRIRMTHSLVMNYGLYKKM
EIYRAKPASKYEMTQFHTDEYIDFLSKVTPDNMDQFSKEQGKYNVGDDCPVFDGLFEFCG
ISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRVL
YVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGQGKHYAVNFPLRDG
IDDISYKSIFEPVIRSVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVKSF
NLPTMILGGGGYTMRNVARTWAFETGILLGENLGPELPYNDYYEYFAPDYELDVRPSNMD
NANTKDYLDKIRAQVVENLKRTAFAPSVQMTDVPREPLVEGMDDEADAILDDLDEDENKD
KRFTKRRFDQYIEKPGELSDSEDEEENAANGVLRKPQSLKRRNQINYRNVDLDSGLDSGV
ATPQEASSVPDDEMDTTADTKTVEAPLPESDVPPSPSATGSTSRRDEKAAAEPTEMAVDG
PEEASASAAVSHQQSPKPQDEDTTMEDAAVSVPETGQSEKPALPVEGQEEEKKPETPALE
KAAPEASPAVQASPIPGEKDVLDKPETNDATEPVEVKAKEKTPEAPTDQQAVKTEQGTSE
EASENKSSSAPTEVRTNQQPEEPEKGGE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctccgattgacctgaatctcaatggctccggtgatcgcagcaggaaggtt
gcgtacttctacgattcggatgtaggtaactacgcctatgtttcagggcatccgatgaag
ccgcaccgtatcaggatgacacatagcctggttatgaactatggcctctacaagaagatg
gagatttaccgtgcgaaaccggcctcaaagtatgaaatgacacaattccacaccgacgaa
tatatcgacttcctttcaaaagttacaccagacaatatggaccagttttccaaagaacaa
ggcaagtataacgttggggatgactgtccagtttttgacgggctgtttgagttctgtggt
atcagcgctggcggcagcatggagggtgcggcacgccttaaccgcaacaaatgcgacatc
gctgttaactgggccggagggctccatcacgcgaagaagagcgaagcgagtggtttctgc
tatgtaaatgatatcgttcttggtatcctcgagctgttacgtttcaagcaaagagttctt
tacgtcgatatcgatgtccaccacggcgacggtgtcgaggaagcgttctacacaactgac
cgcgtcatgactgtctcattccacaagtacggagaatacttcccgggaactggcgagctt
cgtgatattggagtgggacagggcaaacactatgctgttaactttccacttcgcgatggt
atcgatgacatttcgtacaagagtatttttgagcccgttatccgaagtgtcatggaatgg
taccgcccagaagctgtcgtccttcagtgtggtggtgacagtctctcgggtgatcgtcta
ggttgtttcaatttgagcatgaggggccacgcgaactgtgtgaacttcgtcaagagcttc
aatttaccgaccatgatcctcggtggcggtggttacacaatgcgcaatgttgcgcgaacg
tgggcgtttgagactgggattctgttaggggaaaacttgggtccagaactcccttacaat
gactattacgagtactttgcaccggactacgagctggatgtgcgtccgtcgaacatggac
aatgccaacacgaaggattatctcgacaagatccgagctcaggtggtagagaatctcaag
cggacggcttttgcaccctctgtgcagatgaccgacgtacctcgcgaacctcttgttgaa
ggcatggacgatgaggcagacgcaatcctggatgaccttgacgaagacgaaaacaaggac
aaacgcttcacgaaacgacgattcgatcagtatatcgagaagcctggtgaactcagcgat
agtgaagacgaggaagagaatgcagcgaacggagttcttcgcaagcctcaatcgctgaag
cgcagaaaccagatcaactatcggaatgtcgaccttgactccgggcttgatagcggggtt
gccactcctcaagaagcctcgtcggtcccggatgacgagatggacaccactgcggatacg
aaaacggtcgaagcacctctacccgagtctgatgttccaccctctccgtccgccaccgga
tcaacttctaggagagacgagaaagcggctgcagagcctactgagatggctgttgacgga
ccagaggaggcttccgcttccgctgctgtctctcaccaacaatcaccgaagccgcaggat
gaggacactacgatggaagacgcagccgtgtctgtccctgaaactgggcagtcagagaaa
ccagcgttgccagttgagggacaggaagaggagaagaagccagagacaccggctctggaa
aaggcagccccagaggcttcacctgccgtccaggcttcgcctattccaggcgagaaggac
gtcttggacaagccagaaacgaatgatgcaacggaaccggtagaggtcaaggccaaggag
aagactcctgaggcacctactgatcaacaggctgtgaaaaccgagcagggcacttccgag
gaggccagcgaaaacaagtcaagcagcgcccccacagaagtaagaacaaatcagcaacct
gaggagcccgagaaaggcggggaatga

DBGET integrated database retrieval system