KEGG   Aspergillus fumigatus: AFUA_2G04720Help
Entry
AFUA_2G04720      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
afm  Aspergillus fumigatus
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:afm04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1108 aa AA seqDB search
MTLDAASLPSPPNFAPWKNPDRLHSSGGMQSGVERNGRSGSHQNGNHASSRIPRFPNIKD
LQDEAASLDVSESTALSDLLGRAQEAIELAREYADTEELDKAYVQYLRASEITINIIPHH
PDYRVTVSQSPAWYKQFASLMMAVRTKQGTMDDIKQQILEDNLASNIQPLGPSRLATSGH
QGTAAATSQGAVSRGRQSEAGESSVRMPSPSEFQRAPDTRPKPNRYSAPAEDLLAQRFAK
LRASPYPVNGQNHPNKGQNGATTTPSPPKYSNDYPPRPFSYIQQSSQSSANLTSPSRRPL
GPRNMGTNHDLPNPPPKIPLNTSLPRAPDPAYSPIWTVPSQPPSNPPRTSTESSRPVNPR
YSQLANSPRGSPSRGGLDDNPYRSTTPNGVHHVKEARSSSADLPHSTTITAQALLEYLRK
YNVLLIDVRPREEFDGGHIYAKSIICIEPVALKENVSAEELEERLVVSPEHEQLLFERRN
EFDLVVYYDQKTDSVSYLAGSPVGTTAPHLRALHDTLYEFNEYKPLKDARPPALLLGGLD
AWIDLFGQQSLATSTTAAVMGSIQAKRPAMRPGRPLGRVPTMASANSSLEVRKRRLREYK
PLNPEELTAWMEKSKNEEIDTSTYIEEEVLTEEPEDASEQQEPPVTPFVHTYEDFLRRFP
EPHAIQESMIVPHSQPSIPSSTPNYAAPVPVVPSRPPPAVPRPSYSGVSDGRQIQAPLER
QNSATKTALYTPSSMLSRLKLPRTGLTNFGVTCYMNSTIQCLSATVMLSKFFIDNRFRFY
VQKNWKGSQGIMPGLFANLIRSLWKNDVEVIMPTSFRNFCGRLNQEWAIDRQQDAKEFFD
FVVDCLHEDLNINWQRTPLRPLTFEEEMQRERMPVPKVSKIEWDRYCHREESFISSLFAG
QHASRLRCTTCKRTSTTYEAFYSISVEIPHTGTGDIYQCLRSYCQEELLSGDEVWKCPYC
KCQRVATKQIIITRAPQILVIHFKRFSASKTQSARKIHTPIDFPLHGLRMDDFVISANPG
SATDDRAADMTSATTGPFTYDAYGVLRHIGSTMGSGHYISLVRDAQRQCWRKFDDERATD
FNPRDLRFKDRLQNEQAYIVFYERVPAK
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgaccttggatgcagcatcgttaccctctccgccgaattttgcgccatggaagaatccc
gatcggctgcactcttcgggtggcatgcaatcgggcgtggagcgaaatggcagatcaggt
tcacatcaaaacggcaaccatgcctcctcccgaattccacgatttccgaacattaaggat
cttcaagatgaagcagcctctctggacgtgagcgaatcaactgcgttgagtgatttgttg
ggacgcgcacaggaggcgatcgagctagctagagagtacgctgataccgaagaattggac
aaagcttatgtgcaatacctgcgtgcatctgagatcactatcaacatcataccgcaccac
cccgactaccgcgttaccgtcagccagagcccggcatggtacaagcaatttgcgagtctt
atgatggctgtacggacgaagcaagggacgatggacgatatcaaacaacagattttggag
gataatttggctagcaatatccaaccgctaggaccatcccgcttggctacatcaggacat
cagggaaccgccgcggcaacatctcagggtgcagtttctagaggccgtcagagtgaggca
ggcgagagttcagtacggatgccgagtccttcagaatttcaaagagcgcctgacacacga
ccgaagccgaacaggtattcggcccctgccgaggacctacttgcccaacgcttcgctaaa
ctaagggcatcaccatatcctgtcaatggtcaaaatcatccgaataaaggacaaaatggt
gcaactacaacgccttcgccgcctaaatactctaatgactatcctcctcgtccgttctct
tacatacagcaaagttcacaatctagcgcaaacttgacctcaccctctaggcgccctcta
gggccccgtaacatggggaccaaccacgacttaccgaatccgcctccaaagataccgctt
aatacctctcttcctcgggcacctgatccagcgtatagtccaatatggacagtgccttct
cagcccccatcaaatccgccgagaacatctaccgaaagctcccgccctgtcaatccgcga
tactcacaattagccaactctccccgtggcagtcccagtcgtggtggtcttgatgacaat
ccctatcgatctacgacgccaaatggcgtccaccatgtcaaagaagccaggagtagctcc
gcagatctaccgcatagcactactatcaccgctcaagctttactggagtaccttcgcaaa
tacaacgttttgttgatcgatgtgcgacctcgcgaggaatttgacggaggtcatatttac
gccaaatcaatcatttgcattgaaccggtggcattgaaagagaacgtgtctgcggaggaa
ctggaagagcggctggtggtatcgcctgagcatgaacagttactgtttgagaggcgcaat
gagtttgacctcgttgtgtactatgaccagaaaacagattcggtcagctaccttgcgggg
tctcctgttgggacaacagctcctcatcttcgagccttgcacgacacactgtatgagttt
aatgagtacaagcccttgaaagatgcacggccacctgcgttactattgggcggactcgat
gcatggattgacctctttgggcagcagtctttggcaacatcgacgactgctgccgtaatg
ggatccatacaggccaagaggccggcgatgagaccgggtagacctcttgggagggtaccg
actatggcgagtgccaattccagtctggaagtccgaaaaagaagactgcgcgaatataag
cctttgaatccggaagaattgaccgcgtggatggagaagtcgaagaatgaggagatcgac
acaagcacctatatcgaggaggaagtgctgacagaggaaccggaagatgcttctgaacag
caagagcctccggttacaccttttgtgcatacatacgaggacttcttgcgacgtttcccc
gaaccgcatgcaattcaggaatcgatgattgtgcctcactctcagccatcgataccttcc
tcaacaccaaattacgctgctcccgtacccgttgtgccatcacgaccaccccccgccgta
ccacgacccagctatagtggcgtctcagatggtcggcaaattcaggcacccctggaacgg
cagaattcggcgaccaaaacagctttgtatactcccagttctatgttgagtcgcctcaaa
cttccacggactggtttgaccaacttcggggtgacttgctacatgaactcgaccatccaa
tgtctcagcgcgaccgtaatgcttagcaagttcttcattgacaaccgattccggttctac
gtgcagaagaattggaaaggatcacaaggcatcatgcctgggctatttgcgaatctgatt
aggtcgctgtggaagaacgatgttgaggtgatcatgccgacatcatttcgcaatttttgc
ggccgcttgaatcaagagtgggccatcgatcggcaacaggacgccaaggagttttttgac
tttgtggtggactgtttgcatgaggacctcaacatcaactggcagaggactcctctccgg
ccgctcacattcgaggaagaaatgcagcgggagcggatgcctgtacccaaggtctccaag
attgagtgggaccgctactgtcaccgggaagaatccttcatctcctcactgtttgctggc
cagcatgccagtcgacttcgatgtacgacctgcaagcggacgtcaacaacatatgaggct
ttctacagtatcagtgttgagattccacacaccggcacgggcgacatctatcaatgcctg
cgtagttactgccaggaggaactgctgagtggggatgaagtgtggaagtgtccttattgc
aaatgtcagagggtggcaacgaaacagatcatcatcacccgggcgcctcagattctcgtc
atccactttaaaagattttcagcatcaaaaacacaaagtgcgcggaagatccatacaccc
attgattttcctttgcatgggcttcggatggatgatttcgtcatctctgcgaaccctgga
tctgccaccgatgaccgggctgcagacatgacttctgcgaccacagggccttttacgtat
gatgcgtatggggtgttacgccatattggatcgaccatggggagcggacattatatatcg
ctggtgcgggatgcgcagcgccaatgctggcgcaagtttgacgatgagcgggcgaccgac
tttaacccacgcgatctgcgtttcaaggaccggctgcagaacgaacaggcatatattgta
ttctacgagcgagtcccggcgaaatga

DBGET integrated database retrieval system