KEGG   Aspergillus fumigatus: AFUA_2G05530Help
Entry
AFUA_2G05530      CDS       T01017                                 

Definition
histone acetyltransferase (Esa1) (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 483 aa AA seqDB search
MLLLMFALLQDGELRKAEILSIRQRKDGPSFYVHYVDFNKRLDEWIDASRLDLSHEVEWP
QPEKPEKKKTGVGNKAPSKNAQKRARADSRDVSATPDLLTGKNVNVGKAQRPSKAGGKEN
RDGTPLSMPIVTAEAISTDGTPKAESDDVEMVDVSFTDGKSIKEEERALGLMSREEEIER
LRTSGSMTQNPTEIHRVRNLNRLQMGKYDIEPWYFSPYPASFSDADIIYIDEFCLSYFDD
KRAFERHRTKCTLVHPPGNEIYRDDYISFFEVDGRRQRTWCRNLCLLSKLFLDHKTLYYD
VDPFLFYCMCTRDETGCHLVGYFSKEKDSAEGYNLACILTLPQYQRRGFGRLLISFSYEL
SKREGKLGSPEKPLSDLGLLGYRQYWRETLVEILMEPGRETVSENELALLTSMTEKDVHE
TLVVLNMLRYYKGNWVIVLTDYVVEQHKKRLEKEKLKGARKIDPARLQWKPPVFTASSRT
WNW
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgctgatgtttgctttgctacaggacggcgagttgagaaaagcagaaattcta
tcgatcaggcagcgtaaagatggtcctagcttctatgttcactatgtcgatttcaacaaa
cgtttagatgaatggattgatgcttctcgactggacctgtctcatgaagttgagtggcct
cagccggagaaaccagagaagaagaagaccggtgttggtaacaaagcaccaagcaaaaat
gcgcagaaacgtgcaagagccgatagtcgtgatgtctctgcaacaccagatcttctcaca
ggcaagaatgtgaatgttggcaaggcacaacgtccgtccaaggcaggtggtaaagagaac
cgtgacggaactcctctcagtatgcccatcgtcacagcagaggccatctcaacagacgga
acccctaaggcggagtctgacgatgtcgaaatggttgacgtcagcttcacggacggcaaa
agcatcaaagaagaggagagagcgttgggactcatgtcgcgcgaagaagagatcgaacga
ctgcgaacgagcggtagtatgacacagaacccaacggaaatccatcgtgttcgtaacttg
aatcgtcttcaaatgggcaaatacgacattgagccctggtacttctcgccttatcccgct
tccttctcagacgctgatatcatctatatcgacgagttctgtctgagctatttcgacgac
aaacgtgcctttgaacgccaccgtaccaagtgcacgcttgtccatcctcctggcaacgag
atataccgcgatgactacatctcctttttcgaagttgatggccgccggcagaggacgtgg
tgccgtaatctttgtctgctgagcaaactcttccttgatcacaaaaccctatactacgat
gtcgacccattcctcttctactgtatgtgcacgagagacgagacaggctgccatcttgtg
ggctacttctccaaggaaaaggactccgcggaaggctacaatttggcttgtatcttgaca
ctacctcagtaccaacggcgtgggttcggtcggctgcttatctccttcagctatgagctc
agcaagcgcgagggaaaactcggttctcctgaaaagccgctcagtgaccttggtctactg
ggttaccgtcaatattggcgagaaacgctcgtcgaaatactcatggaacctggacgagaa
acagtcagtgagaatgaactcgctctattgacttcgatgactgaaaaagacgtccatgag
accctggtcgtcctgaacatgctgcgttactataaaggaaactgggtcatcgttctcacc
gactacgtggttgaacagcacaagaagcgtcttgaaaaagagaaactgaagggagctcgc
aagattgacccagcgcgccttcagtggaaacctcccgtgttcaccgcttcaagccggaca
tggaactggtga

DBGET integrated database retrieval system