KEGG   Aspergillus fumigatus: AFUA_2G05590Help
Entry
AFUA_2G05590      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase L3 (EC:3.1.2.15)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AFUA_2G05590
Peptidases [BR:afm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AFUA_2G05590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 250 aa AA seqDB search
MTENVDVPTTNKAFVPLENNPEVMSHLVHQLGLPPTLGFTDVYSIDEPDLLALVPRPSHA
LLLVFPITPSYEASRVAEDGPLPEYNGSGPGEPVMWFKQTIRNACGLIGLLHAVANGEPR
KHVIPGSDLDALLREAEPLGPIARADLLYESKALESAHADAARLGDTAAPQAEDNVDLHF
VAFVKGSDGRLWELDGRRKGPLERGRLADNEDALSDKALGLGVRRFLQTEVRAGNPDLRF
SLVSLGPSFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaatgttgatgttcccaccacaaacaaggccttcgtgcctcttgaaaacaac
ccagaagtcatgtcccaccttgtccaccaactgggcctcccacccacactcggcttcaca
gacgtctactcaatcgacgagcccgacctcctcgccctcgtcccccggccctcacacgct
ctcctcctcgttttccctattactccatcctacgaagcctcccgagtcgctgaagacggg
cccttacccgaatacaacggctccggccccggagagccagtaatgtggtttaagcagacg
atccgcaacgcctgcgggctgatcggactcctgcacgccgttgcaaacggcgaaccgcgc
aaacatgtcatcccgggctccgatctggatgctcttcttcgtgaagcggagccgctgggg
cccatcgccagggcggacttgctgtatgagagtaaggcgttagagagtgcgcatgcggac
gcggcgcggttgggggatacggctgcgccgcaggcggaggataacgttgatttgcacttt
gttgcgttcgtgaaggggtctgatgggcggctgtgggagcttgatgggaggaggaaaggg
ccgttggagagaggacgattggcagataatgaggatgcgttgagcgataaggcgctgggg
ttgggggtcaggaggtttttgcagacggaggttcgggcgggtaatccggatttgaggttc
agtctggttagtctgggaccttctttcgagtga

DBGET integrated database retrieval system