KEGG   Aspergillus fumigatus: AFUA_2G07940Help
Entry
AFUA_2G07940      CDS       T01017                                 

Definition
NADPH-cytochrome P450 reductase (CprA) (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 710 aa AA seqDB search
MSLFSQWSSHPEILRDLFKVPSPASVADYAALTVVSIIAGTYVSRGILWDRPDPYLHLVY
ERPQLKNGGAAGSNANKQTRDVAQKMDETGKTIVVFWGSQSGTAEGFAHRLAREVSLRFG
QEAMTADLSDYDPDSVSRIPNSKLAIFILSTYGEGDPSDNTAEFWDWIHKSQNVSLSNLR
YAAFGLGNSNYKFYNRVVDVVVEALDRFGAKSLMPVGKANDAEGTTQEDFMSWKENLFAT
FKQQLGFQEAEVKYMPTLSVQEDESLAPIDLHHGEPDIRRDSVKSAAQCSPVRAVDISSS
RELFASSDRHCLHIELDLSSQPEFTYKTGDHLAVWAGNPDAEVDILVNALGLPPSRHEIP
ISITSLDPATKVRVPTPTTPIALFRYYLEICAPVNRDTLLGLAQFAPTPAAKDFLLQLGQ
DKTAYASFLNHTHLTLGRLLQLACPDTPWTALPLSYLIETLTPIQPRYYSISSSSVLAPR
KPSITVLVSCTPLPADPTQSIHGLTSNYLLALSASLASSRHPHGLTYPLAGPNASLTGGK
IHAHLRRSRFKLPLMSKCPLVMVAAGTGLAPFRAFIAERRQLSLIGKEIGEMILFFGCRA
PTQDFIYKEELEELQAALGDKLRVITAFSREVGSQKVYVQDRIAEHAAEVIRLIDEGASV
YICGRAGMAREVEKTVGEAMRAAKRWSETELNEWSRAIKRKNKWQEDVWG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttttctctcaatggagctcgcatcccgagattcttcgggatcttttcaaagta
cccagccctgcaagtgtcgccgactatgccgctttgactgtcgtcagcatcatagcgggt
acctatgtctcccgaggcattctctgggaccggcccgatccttatctccatcttgtgtac
gaacggccgcaattgaagaatggcggcgcggctggctccaatgccaacaagcagacccgc
gacgttgctcagaaaatggacgaaacgggcaagaccattgtggtcttttggggctcccag
tctggcactgccgaaggctttgcgcaccggctggcccgcgaagtctcgctgcggttcggt
caggaggctatgacagccgacttgtcagattatgatccagactctgtcagtaggatccca
aactccaaactggcgatcttcattctctcgacctacggtgagggtgatcccagcgacaac
accgccgagttctgggattggatccataagtcccagaacgtgtctctgtccaacctccgc
tacgctgctttcggcttgggcaacagcaactacaagttctacaaccgcgtcgttgatgtc
gtcgtggaagctctggatcggtttggggctaagtcgttgatgcccgtcggcaaggcgaac
gatgctgaaggcacaacacaagaggatttcatgagttggaaggagaatttgtttgccacg
ttcaaacagcagctgggttttcaggaagccgaggtcaagtatatgccgacgctgtccgtc
caggaagacgagtcgcttgcgcccatcgaccttcaccatggagaaccggacattcgccga
gactcggtcaaatccgctgctcaatgctcgcccgtacgggcagttgacatcagcagctcc
agggagctcttcgcctcctccgatcgccactgtcttcacatcgaacttgatctcagcagt
caacccgagttcacgtacaagaccggtgatcatctggccgtctgggcgggcaatccagat
gccgaagtggacatcctcgtcaacgccctggggcttcctccgtctcgccacgaaataccc
atcagcatcacatcgctcgacccagcaactaaagtgagagttccgactcccacgaccccc
atcgccctcttccgctactatctggagatctgtgcccctgtcaaccgcgacactctcctc
ggactcgcccagttcgcccccacgccagcagccaaggacttccttctccagctcgggcag
gacaaaaccgcctatgccagcttcctcaaccacacccacctcacccttggtcggcttctg
cagctcgcctgccccgataccccgtggacagccctcccactctcctatctcatcgagacg
ctcaccccaatccaaccccgctactactccatctcctccagcagtgtcctcgccccacgc
aaaccatccatcaccgtccttgtctcctgcaccccgctcccagcggacccaacccaatcc
atccacggcttaacatccaactacctcctcgccctctccgcatccctcgcctcgtcccgc
cacccccacggcctcacctacccgctcgccggtcccaacgccagcctgactggcggcaaa
atccacgcccacctgcgccgcagccgcttcaaactcccactcatgagtaaatgcccgctc
gtcatggtcgcagccggcacggggctggcccccttccgcgccttcatcgccgagcgccgc
cagctgagcctcatcggcaaggaaatcggcgagatgatcctttttttcgggtgccgggcc
ccgacgcaggatttcatctacaaggaagaactggaggaattgcaggccgctcttggcgat
aaactccgcgtcatcactgcgttctcgcgagaagtcggcagccagaaagtctacgttcag
gatcggattgcggaacatgccgccgaggtgatccggctgatcgacgagggcgcgagcgtg
tacatctgcggccgggcggggatggcccgcgaggtggaaaagacagttggggaggcaatg
cgagcggccaagaggtggagcgagaccgaactaaatgagtggagtagggcaatcaagagg
aagaataagtggcaggaggatgtatgggggtag

DBGET integrated database retrieval system