KEGG   Aspergillus fumigatus: AFUA_2G08510Help
Entry
AFUA_2G08510      CDS       T01017                                 

Definition
SET domain protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
afm  Aspergillus fumigatus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AFUA_2G08510
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFUA_2G08510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 622 aa AA seqDB search
MPSAKKRDSPSVDRRDRLTLAKLASYDDIATDALVDRAYFWTNTRKNRTKYNPMRGIVDD
DVARVLLHDVIVAKDLAKAERELLAMSGLKKFMARLPNNREKDWFRRHLRKYIQMYLPDS
PFEITTTNRYTITEYEAAVCARKFIKQGQEIKYLSGTLVPMTREEERDLDLKRKDFSIVM
SSRKKTPSFFLGPARFANHDCNANGKLVTRGSEGMQVVATRDIYIGEEITVSYGDDYFGI
DNCECLCLTCERLVRNGWAPHVPSEPQSKASTPALNDDTLSTDSHVSSKKRKFAPDSDIE
TSAPSTPCKRGKFVRQSSKLKSEVSFLEVATSIEQPAGPSPVCNGSDMGALGNSTVESDN
DKAVDPALPSPPADSPPSTAANESERSSTSTTATSVCDAAVKIKVEETIEQSAEKVSALS
EANVELPTTSLRSGSTEGDTKLELSDQPSTLKQGSIGSNRKERRKSRGKPLVVESVEAER
QLVRVPGDYTKTSKLLAQTYDRWVDCHTCNAWFVQHDSYLTRRECPRCERHSMLYGYRWP
KTDKEGPSDDEERVMDHRTVHRFLYPEEEALISRKDRGVSFGVTPTPELSEPRTETEGSE
GCEDRRTTRASRRRTRSLRMTM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccgcaaagaaaagagatagcccgtctgtcgaccgtcgcgaccgtctgacgctt
gcgaaactggccagctacgacgatatcgcgacggatgcgctggtggaccgagcttacttc
tggaccaatactcgcaagaacagaaccaaatacaaccctatgcggggcattgttgacgat
gatgtcgctcgcgtccttctgcacgatgtcattgtcgcaaaggatctcgcgaaagcagaa
cgagaactgctggcgatgtcagggctgaagaaattcatggcccggttgcccaacaatcgt
gagaaggattggttccgccgtcacctgcgtaaatacatccagatgtacctgcctgactcc
ccgtttgagatcaccacgaccaatcgctacacaattacggaatatgaggctgcagtctgc
gctcgcaaattcatcaagcaaggacaggaaatcaagtatctcagcggaactcttgtccca
atgactcgcgaagaagagcgggatcttgacctgaagcggaaggatttcagcatagtgatg
tccagcaggaaaaagactccatcttttttccttgggcctgctagatttgccaaccacgac
tgtaatgcgaacggaaaattggtgacacgtggatccgaaggcatgcaggtcgtcgctact
cgtgacatctacattggcgaagagattacagtatcctacggagacgactatttcgggatt
gacaactgcgagtgtttgtgtcttacctgcgaacggctggtccgcaatggctgggcgccg
catgtgccatcagagcctcagagtaaggcgtccacgccagcgttaaacgatgatactctg
tcaaccgacagccacgtctcatctaagaaacgcaaatttgcgcctgactcagatattgaa
acttctgctccgtccactccttgcaaacgaggaaaatttgtccgccagagttccaaattg
aaatcggaagtgtcattcctcgaagttgctacttcgattgagcaacctgctggtccttca
cccgtgtgcaacgggtctgatatgggggccttgggtaacagtactgtcgagtctgacaat
gacaaggccgtggaccctgccctgccttctccgcccgctgattctcctccgtcaactgct
gcgaacgaatcagaacgctcatcaacatcaacaaccgccacctctgtgtgtgatgctgcg
gtcaaaatcaaagtagaagaaacaatagaacaatctgcagagaaagtttccgccctatct
gaggcaaatgttgagctgccgaccacgtctctgcggtcaggcagcactgagggagacaca
aaattagaactatcagaccagccgagcacattaaaacagggatctattggttctaacaga
aaggagcgcagaaagtctcgcggaaaaccccttgttgttgagtcggtggaggctgagcgc
caactcgtccgtgttccaggggattataccaagacttcgaaacttttggcgcagacatac
gaccgctgggttgactgccacacttgtaatgcctggtttgtgcaacatgactcctacttg
actcgacgagagtgccctcgctgcgagcgtcactctatgttgtatgggtaccgctggcct
aagactgataaggagggcccgtcggacgatgaagaacgagtgatggaccatcggacggtg
caccgtttcctataccccgaggaagaggccctcatctcgcgtaaagatcgcggcgtcagt
tttggtgtaacgcccacgccagaattatccgagccacgcacagaaaccgaaggaagcgaa
ggctgtgaggacaggcgcactactcgtgcgagccggcgccgcactcggtcgcttcgaatg
acaatgtga

DBGET integrated database retrieval system