KEGG   Aspergillus fumigatus: AFUA_2G08620Help
Entry
AFUA_2G08620      CDS       T01017                                 

Definition
20S cyclosome subunit (BimA/Nuc2/Cdc27)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
afm  Aspergillus fumigatus
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AFUA_2G08620
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AFUA_2G08620
   04113 Meiosis - yeast
    AFUA_2G08620
Protein phosphatases and associated proteins [BR:afm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AFUA_2G08620
Ubiquitin system [BR:afm04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     AFUA_2G08620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 809 aa AA seqDB search
MSPSISYISGQLRQLIYYHLDNNLCRNALFLAGRLHAYEPRTAEASYLLALCHLQNGQVK
AAYDYSRNFGSRGTHLGCSYVFAQACLDLGKYLEGITALERSKGLWASKNHWNKHSETRR
QHLPDAAAVFCLLGKLWHAHKDINKAVECYVESLKLNPFMWDAFQGLCDTGVNVRVSNIY
KLNSELLAVLSSSPQADAEPISDKSAHTNGPLQAQANVNPSSDPFASTTSRSDSGTSHGS
SALWEKLNGSTVSVASSGVPASIVHEGAETPSGQSSGSDEFRLANGMNGADASWDPPLAP
ARKNRTIQAISGEYPMDPPPKMKPTGIRPRTRTRTEPEDQISAQIDREATNAPRVGDRKR
TVSGQVAHPPTSQPTEPGAPQRRSVRLFNQIKPTTSKLSASALGVKDAREVKKAKATGTK
GRTTTTTMGRVVSGSRKHASEHHDADGKDGRSVPSAHTHAISKGAAQERSKEIEALTWLL
ELFSKLASGFFALCRYRCPESIQIFNSLSQGQRETPWVLAQIGRAYYEQAMYSEAEKYFY
RVKTMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMETDRLSPQAWCAIGNSFSHQRDH
DQALKCFKRATQLDPQFAYGFTLQGHEYVANEEYDKALDAYRHGISADSRHYNAWYGLGT
VYDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPKAALVQYGRACSLAPHSV
LARFRKARALMKLQELKLALSELKILKDMAPDEANVHYLLGKLYKMLHDKANAIKHFTTA
LNLDPKAAQYIKDAMESLDDDEEDDEDMS
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcaatatcctacatttcaggccagcttaggcagctaatatactatcatctc
gataacaatttgtgccgtaatgcgctgttcctcgccggtcgtttacatgcttacgagccc
cgaacggcggaagcgtcgtatttactcgctctctgccatcttcagaacgggcaagtcaaa
gccgcatacgattacagcaggaattttggatcgagaggcacccacctcggctgctcctat
gtcttcgcgcaagcgtgcttggacctaggaaagtatctggaaggtatcacagcgttagag
cggagtaaaggcctttgggcttcgaagaaccactggaataagcacagtgagacgcgaaga
caacatctgccggatgcagccgcagtattctgcctgttaggtaaattatggcatgcgcat
aaggacatcaacaaagctgtggaatgctatgttgaatctctgaagctgaatcccttcatg
tgggatgcgttccaagggttgtgcgacaccggagtcaatgtccgcgtgtcaaacatctac
aagttgaattctgaattgctggccgtattgtcttcatcgccacaggcggatgctgagcca
atatccgataagtctgcacacacgaatgggccactgcaagcgcaggcgaatgttaatcca
agttccgatccttttgcctcgactacttctcgcagtgattcaggtaccagccatgggagc
tctgccttgtgggaaaaactaaatggaagcacagtaagcgtggcgtcatcgggagtgcca
gcatcaatcgtgcatgaaggagccgaaacgccgagtggtcaaagcagcggatctgatgag
ttccggttagctaacggaatgaacggcgcggatgcttcttgggaccctcctttagctcct
gcaaggaaaaacagaacgatccaggcaataagcggcgagtatccaatggaccctcctccc
aagatgaaacccactgggatccgaccaaggacaaggaccaggactgagccggaggaccaa
atttcagcccagatagaccgggaggcaacaaatgcgcccagggtcggggaccgcaaacga
actgtttctggtcaggtagcgcatccaccgacgtcacaacccacagaaccaggagcaccc
cagcggcggagtgtgcgactcttcaaccagattaaacccacgaccagcaaattgtcggcg
tccgcgctgggagtcaaggatgctagagaagtcaagaaagcgaaagccacaggtacgaag
gggcgtacgacaaccaccaccatgggacgagtagtgagtggcagccgaaaacatgccagc
gaacatcatgatgcagatggtaaagacggacggtcggtaccgtccgcccacactcacgcc
atctccaaaggcgctgctcaagaaagatcgaaagaaatcgaggcgttgacctggctgctg
gagctattctcgaaacttgcttctggattctttgccttgtgtcgctaccgatgcccagag
tcaatccagatcttcaattcgctctctcaaggccaacgggaaacaccgtgggttctcgct
cagattggacgagcgtactatgagcaggctatgtattccgaggcagaaaagtacttctac
cgtgtgaagaccatggcaccctcgcgcttggaagacatggagatctactcgactgtcctt
tggcatctgaagaacgatgttgagttagcctatttggcgcatgagttgatggaaacagac
cgcctgtcgccacaggcgtggtgcgccatcggtaattcgttttcccaccagcgagatcat
gaccaggccttgaagtgctttaagcgggcaacccagctggatcctcagtttgcctacggg
tttactcttcaagggcacgagtatgttgccaacgaagaatacgacaaggcgcttgatgca
taccgtcacggtatcagcgcggatagtcggcattacaatgcttggtacggactgggcacg
gtttatgacaaaatgggcaaactggactttgccgaacaacacttccggaatgcggcaagc
attaacccgaccaacgcagttttgatctgctgcattggattggtactggaaaaaatgaac
aaccctaaagcggctctcgtgcaatatggtcgcgcttgttccttggcacctcattccgta
ctcgcgcgattccgcaaggcccgcgcattgatgaagctccaggagctcaaattagctctg
tctgagttgaagattctcaaagacatggctccagacgaagctaacgtgcattatctgttg
ggtaagctctacaaaatgcttcacgacaaagccaatgccattaagcacttcacaactgct
ttgaacttggatccaaaggcagcacaatacatcaaggatgccatggaatctcttgacgat
gacgaggaggatgatgaggacatgagctga

DBGET integrated database retrieval system