KEGG   Aspergillus fumigatus: AFUA_2G08670Help
Entry
AFUA_2G08670      CDS       T01017                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
afm  Aspergillus fumigatus
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:afm01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:afm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:afm00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:afm00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:afm00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 2292 aa AA seqDB search
MGVPNGSSSNGHVSSRAAKHNLPSHFIGGNHLDAAPPSSVKDFVASHEGHSVISSVLIAN
NGIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLRANADYIRMADQYVEVPGGTNNN
NYANVELIVDVAERMNVHAVWAGWGHASENPRLPEALAASPKKIIFIGPPASAMRSLGDK
ISSTIVAQHAGVPCIPWSGTGVDEVTIDENGIVTVPDEIYKRGCTFSPEEGLKKAKEIGF
PVMVKASEGGGGKGIRKVEREEDFISLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQ
YGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPATFQAMERAAVSLGKLVGYVSAGTVEYL
YSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPN
TSSEIDFDFSSEESFKTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVW
GYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLL
ETPAFEDNTITTGWLDQLISNKLTAERPDPIVAVLCGAVTKAHLASEGGVEEYRKGLEKG
QVPSNDVLKTVFPVDFIYEGQRYKFTATRAGLDSYHLFINGSKCSVGVRALADGGLLVLL
NGRSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPSPGKLVKFTVENGEHVKAGQA
FAEVEVMKMYMPLIAQEDGIVQLIKQPGSTLEAGDILGILALDDPSRVTHAQPFTGQLPD
LGPPQVVGNKPPQRFSLLHSILENILMGYDNQVIMNTTLKELVEVLRDPELPYGEWNAQS
SALHSRMPQKLDAQLQSIVDKAHARKAEFPAKQLQKTISRFIEENVNPADAEILKTTLLP
LQQVITKYMDGLKAHEFNVFAGLLEQYYKVESLFSGRNIRDEDAILKLREEHKDDIGSVV
QLVLSHSRIGAKNNLILAILAMYRPNQPGAGNVAKYFKPVLKKLTELESRPAAKVTLKAR
EVLIQCALPSMEERMSQMELILRSSVVESRYGETGWDHREPEFSVLKEVVDSKYTVFDVL
TRFFVHPDPWVTLAALEVYIRRAYRAYTLKGIQYYPDGEVPLVSWDFTLGKLGQPEFGSV
HSNQMSTPSTPTTESNPFRRLNSISDMSYLVNDSSNEPLRKGVIVPVQYLEDAEEQLPKA
LEALPRAGSKRKPGENGLIADLEGKRRPAPRIESDNELTGVCNVAVRDLEDLDDNQIVAQ
INTILAGLRDELLARRVRRVTFICGKDGSYPGYFTFRGPTYEEDESIRHSEPALAFQLEL
GRLSKFKIKPVFTENRNIHVYEAIGKGPENDNAVDKRYFVRAVVRPGRLRDDIPTAEYLI
SEADRLMNDILDALEIIGNNNSDLNHIFINFSPVFNLQPQDVEEALAGFLERFGRRLWRL
RVTGAEIRILCTDPATGMPYPLRVIITNTYGFIIQVELYIEKKSEKGEWLLHSIGGTNKL
GSMHLRPVSTPYPTKEWLQPKRYKAHVMGTQYVYDFPELFRQAFQNSWAKAVAKIPSLAS
KRPAVGDCIEYSELVLDDTDNLIEISRGPGTNTHGMVGWIVTARTPEYPEGRRFIIVAND
ITFQIGSFGPQEDKFFYKCTELARKLGIPRIYLSANSGARIGMADELIPYFSVAWNDPQK
PEAGFKYLYLTPEVKQKFDASKKKEVITELIHDEGEERHKITTIIGAKDGLGVECLKGSG
LIAGATSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGRE
VYTSNLQLGGTQIMYKNGVSHMTATDDFEGVQKIVEWMSFVPDKKGASIPILPWSDDWDR
DVAYYPPSKQAYDVRWLIAGKKDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPM
GVIAVETRSVENVTPADPANPDSMEVISQEAGGVWYPNSAFKTAQALRDFNNGEQLPVMI
LANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVIDPTINP
DQMEMYADEEARGGVLEPEGIVNIKYRREKQLDTMARLDATYGELRRALEDPSLSKEQLS
EIKAKMAAREEQLLPVYLQIALQFADLHDRAGRMVAKNTIRKALTWKNARRFFYWRVRRR
LSEELILKRMASVAPAAVSGEATGAIPATGLVDGQTPSNESPRAKHLRTLHSWTGFLDEE
LEHDDRKVAMWYEENRKAIQMKIEALKTDSVATEIAQLLISNKEGGLKGVQQVLSMLPVE
EKEAVLKYLGSP
NT seq 6879 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccccaacggaagctcgagcaacggccatgttagctctcgtgcggccaaacac
aatcttccttcacatttcatcggtggaaatcacttggacgcagcacctccaagcagtgta
aaggatttcgttgccagccatgagggtcactccgtcattagttcggtgctcattgccaac
aatggtatcgcagctgtcaaggagattcggtctgttcggaaatgggcctacgagacattc
ggcaacgaacgggccattcaattcacggtcatggccacaccggaggatttgcgggcaaac
gccgattacattcgtatggccgatcaatatgtggaggtacccggaggcacaaataacaac
aattatgcgaacgtcgagctgatcgtcgatgtggccgagcgaatgaatgtccatgccgtc
tgggctggttggggccacgcatccgagaaccccagacttcccgaagctctggctgcttcc
cccaagaagatcatcttcattggtcctccggcctctgcgatgcgctctctgggtgataag
atctcctcgacaatcgttgcacagcatgcgggtgtgccttgcattccgtggtcaggaacc
ggagttgacgaagtgacaatcgatgagaatggtattgtcaccgttcccgacgagatctac
aagcggggttgtaccttctcccctgaagaaggtctgaagaaggccaaggagattggtttc
cccgtcatggtcaaggcctcggaaggtggtggtggtaagggtatccgtaaggtcgagcgg
gaagaggatttcatcagcctttacaatgccgccgcaaacgagatcccgggctcccctatc
ttcatcatgaagttggctggcaatgcccggcatctggaagtccagctgctggctgatcag
tatggaaacaacatctccctgttcggcagagactgctccgtacagcgtcgtcaccagaag
attatcgaggaggcccccgtcaccatcgccaagcccgccacgttccaggccatggagcgt
gcggctgtcagcctcggaaagctggttggttacgtctccgcgggtaccgtcgagtacctg
tactcgcacgccgatgacaagttctacttcctcgagttgaaccctcgtcttcaggtcgag
caccccaccaccgaaatggtctccggtgtcaacctgccagccgcccaattgcaaatcgcc
atgggtatccctctgcaccgcatccgtgacatccgtctgctctacggggttgaccccaac
acctcgtccgagattgacttcgacttctccagcgaagagagcttcaaaacgcagcgccgc
cctcagcccaagggacacacgaccgcctgccgtatcacttccgaagatcccggcgaaggt
ttcaagccctccagcggtaccatgcatgaattgaacttccgcagttcgtccaacgtctgg
ggttacttctccgtcggtaccgccggtggtatccacagcttctccgacagccagttcggt
cacatctttgcctacggtgagaaccgttccgcgtcgcggaaacacatggttgtcgctctg
aaggagttgagcatccggggtgacttccgcacgacagtcgagtacctgatcaagctactg
gagacccctgctttcgaggataacaccatcaccactggatggctggatcagctcatctcg
aacaagctgaccgcagagcgtccggatcccatcgtggctgttctgtgcggtgcggtgacc
aaggctcacctggccagcgaaggcggtgtcgaggagtatcgcaagggcctcgaaaagggt
caggtgccctccaatgacgtcctcaagaccgtcttccccgtggacttcatctacgagggc
cagcggtacaagttcaccgcaaccagagccggcttggacagctaccacctgttcatcaac
ggatccaagtgctcggtcggtgtccgtgctctggccgacggtggcctgcttgtgctcctg
aacggtcgtagtcacaacgtctactggaaggaggaagcggctgcaactcgcctgagtgtc
gacggaaagacgtgcttgctggagcaggagaatgatcctactcagcttcgctccccgtcc
cccggaaagcttgtcaagttcacggtcgagaacggcgagcacgtcaaggctggtcaggcc
ttcgccgaagtcgaggtcatgaagatgtacatgcccctgattgcacaggaagatggtatt
gttcagctcatcaagcagcctggttccaccctcgaggccggtgacatcctcggtattctc
gctctggatgacccatctcgtgtcacacatgcccagccttttaccggacagctgcccgac
cttggtcccccgcaagtggtcggtaacaagcctcctcagagattctccctcctccacagt
attctcgagaacatcctcatgggctatgacaaccaagttatcatgaacaccactctgaag
gagctggttgaggttttgcgggatcctgaacttccttacggtgaatggaacgctcagtct
tctgcccttcattctcgtatgccccagaagctggacgctcagcttcagagcatcgtcgac
aaggctcacgccagaaaggccgagttccccgccaagcagctgcagaagactatctcccgc
ttcatcgaggagaacgtcaacccagccgacgccgagatcctcaaaaccactctcctccct
cttcagcaggtcatcaccaagtacatggatggcctgaaggcccacgagttcaacgtcttc
gctggattgctggagcagtactacaaggtcgagagcctcttctctggccgcaacatccgc
gacgaagatgccatcctgaagctcagagaagagcacaaggacgatattggcagcgtcgtt
cagctggtactgtcccacagccgtattggcgcgaagaacaacctcattttggccatcctg
gccatgtaccgccccaaccagcctggtgctggcaatgtcgcaaagtacttcaagcccgtc
ctgaagaagctcactgaacttgagtcgcggcccgccgccaaggtcaccctcaaggcccgt
gaggtcctcatccagtgtgcgcttccctccatggaggagcgtatgtctcagatggaactc
attctgcgctcctctgttgtcgaatcccgatacggagagaccggttgggaccaccgggag
cccgaattctccgtcctcaaggaagtggtggactccaagtacaccgtcttcgacgtcctg
acccgattcttcgttcatccggacccttgggtcaccctggctgctctcgaggtctacatt
cgccgtgcctacagggcctatacactgaagggtattcagtactaccccgatggagaagtc
cccctggtctcctgggactttacgctaggcaagcttggacaaccggagttcggttccgtt
cactccaaccagatgtctacgcccagcacacctactacggagtccaaccccttcagaaga
ctcaactccattagtgatatgtcataccttgtcaacgacagcagcaatgagcccctcaga
aagggtgtcattgttccggttcagtacctggaagacgccgaggagcagctgcctaaggcc
ttggaggcactccctcgtgccgggtcgaagaggaagccgggcgagaacgggctgattgca
gacctggagggcaagcgtcgaccagcccctcgcattgagtccgacaatgaattgaccggt
gtctgcaacgtggctgtccgtgacctcgaagatcttgacgacaaccagatcgttgcccag
atcaacaccattcttgccggcctcagggacgagttgctcgctcgccgcgtccgccgcgtg
accttcatttgcggcaaggacggcagctaccctggctacttcaccttccgtggacctacc
tacgaggaagatgagagcatccgtcacagcgaacctgcgctcgccttccagcttgaactc
ggacgtctgtccaaattcaagatcaagcccgtcttcaccgagaaccggaacatccacgtc
tacgaggccatcggcaaggggcccgagaacgacaacgctgtcgacaagcgttacttcgtc
cgtgctgtggtgcgcccgggccgtctccgtgacgatattcccaccgcggagtacctcatc
tccgaggctgaccgtctcatgaatgacattctggatgccctggagatcatcggcaacaac
aattctgatctgaaccacatcttcatcaacttctcgccggtgttcaacctgcagccccag
gatgtggaagaggccttggccggtttccttgagcgcttcggtcgccgtctctggcgtctc
cgtgtcaccggtgccgagatccgtattctatgcaccgatcctgccactggcatgccttat
cctctgcgtgtgatcatcaccaacacctacggcttcatcatccaggttgagctgtacatt
gagaagaagtccgagaagggcgagtggctcctccacagcatcggtggtaccaacaagctc
ggctcgatgcacctgcgtcctgtctccacaccctacccgaccaaggagtggcttcagccc
aagcgttacaaggctcatgttatgggcacccaatacgtctacgatttccccgaattgttc
cgacaggccttccagaacagctgggccaaggctgtagccaagatcccctccctggccagc
aagcggcccgcggttggcgactgcattgagtacagcgagcttgttctcgatgataccgac
aacctgatcgaaatctcgagaggcccaggtaccaacacccacggtatggttggatggatc
gttaccgctcgcaccccagagtatcccgaaggccgacggttcatcatcgttgccaacgac
atcaccttccagatcggttccttcggtccccaggaggacaagttcttctacaagtgtacc
gagttggccaggaagcttggaatccctcgtatctacctctcagccaactccggtgctcgc
atcggtatggccgacgagctgatcccctacttctccgtggcttggaacgacccccagaag
cccgaggctggattcaagtacctttacctcactcccgaggtcaagcaaaaattcgatgcc
agtaagaagaaggaggtcattactgagctcattcacgatgagggcgaagagcgccacaag
attacgactatcattggtgctaaagatggcctgggtgttgagtgtctgaagggctctggc
ctcatcgccggagctacctcgcgcgcttacgaggacatcttcaccatcaccctggtcacc
tgccgctccgttggtattggtgcctaccttgtccgtctgggccagagagccatccaagta
gaaggccagccgattattctgactggtgccccggccatcaacaagctgttgggtcgcgag
gtttacacatctaaccttcagctcggtggtactcagatcatgtacaagaacggtgtctct
cacatgactgccaccgatgactttgagggtgtccagaagattgttgagtggatgtccttc
gttcccgacaagaagggtgcatccattcccatcctgccctggtccgatgactgggaccgc
gatgtcgcctactaccctccttctaagcaggcttacgatgtccgctggctcatcgctggt
aaaaaggatgaggaaggcttcctccctggtctgttcgatgccggatcctttgaggaggct
cttggtggatgggctcgtaccgttgtcgttggtcgtgctcgccttggtggcatccctatg
ggtgtaattgctgtcgagactcgttcggttgagaacgttacccctgccgaccctgccaac
cctgactccatggaggtgatcagccaggaagccggtggtgtgtggtacccaaactcggcc
ttcaagaccgctcaggccctccgcgacttcaataatggcgagcagctgcccgtcatgatt
ctggccaactggagaggcttctccggtggccagcgtgacatgtacaacgaggttctcaag
tacggttcctacatcgtcgatgctctggtcaagtacgagcagcccatcttcgtttatatc
ccacctttcggtgaacttcgtggtggttcatgggtcgtcattgatcccacgatcaaccct
gaccagatggagatgtacgctgatgaggaggctcgcggtggtgtcctcgaaccagaaggt
atcgtgaacatcaagtaccgccgtgagaagcagctcgacactatggctcgtctcgacgcc
acgtacggcgagctccgtcgtgctcttgaggacccatccctcagcaaggagcagctctca
gagatcaaggccaagatggccgctcgcgaagagcagctccttcctgtctacctgcagatc
gctctgcaatttgctgatcttcacgaccgcgctggccgcatggtggccaagaataccatc
cgcaaggccctgacctggaagaacgccagacgcttcttctactggcgtgtacgccgccgc
ttgagcgaggagctcattctcaagcgcatggcctctgtcgccccggccgccgtctccggc
gaggccaccggcgccatccctgccaccggactcgtcgacggccagaccccatccaatgag
agccctcgcgctaagcacctgcgcaccctgcactcgtggaccggcttcctggacgaggaa
ctcgagcacgacgaccgcaaggtagccatgtggtacgaggagaacagaaaggccatccag
atgaagatcgaggcccttaagaccgactctgtcgccaccgagatcgcccagctgctcatc
agcaacaaggagggcggtctcaagggtgtgcagcaagttctcagcatgctgcctgtggag
gagaaggaggccgtgctcaagtacctgggctcaccatga

DBGET integrated database retrieval system