KEGG   Aspergillus fumigatus: AFUA_2G08890Help
Entry
AFUA_2G08890      CDS       T01017                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
afm  Aspergillus fumigatus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFUA_2G08890
   00670 One carbon pool by folate
    AFUA_2G08890
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AFUA_2G08890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 252 aa AA seqDB search
MPPSQPLTLIVATTPIRTSENLPTRLGIGLHGTLPWPRIKADMAFFARATSRPPRPGTTN
AIIMGRKTYDSLPQNLRPLAKRINVVITRDSTGSVRERIMKELEAKRAKAAAAAASEQAQ
AQAQKQEQVQAQTDALVSTGLEDALASLEGSYGAEGRLGNVFVIGGGEIYASALRMSETQ
PLRIVMTNVERVDGTEFECDTVFPVDEKLAAGGKWRMASEEEVSGWVGEEVSSRWREEGD
VRIQMVGYERIL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttcgcaacctctaaccctcatcgtcgccacgaccccaatccgcacaagcgaa
aacctccccacccgcctcggcatcggcctgcacggcaccctcccctggccgcgcataaaa
gcagacatggcgttcttcgcgcgagcgacatcacggccccctcgcccgggaaccacaaac
gcgatcatcatgggccgcaagacctacgactcgctgcctcagaacctccgcccgctcgca
aagcgcatcaatgttgtgattacgagggatagtactggctctgtgcgggaacggattatg
aaggagttggaggcgaagagggcgaaggcggcggctgctgctgcttctgagcaggctcag
gcgcaagctcagaaacaagagcaggtgcaggcgcagacagatgctctcgtgagtacaggg
ctggaggacgcgctggcgagtttggagggcagctacggggcggaggggagactggggaat
gtatttgtgattggtgggggggagatatatgcttctgcgttgcggatgagcgagacacaa
ccgcttcgcattgtgatgacgaacgtggagagggtggacgggacagagtttgagtgtgat
acggtgttcccagtagatgagaagcttgcggctggggggaagtggaggatggcgagcgag
gaggaggtgtccgggtgggtgggcgaggaggtctcctcgagatggagggaggagggcgat
gtgcggatccagatggtgggttatgaacggatattgtag

DBGET integrated database retrieval system