KEGG   Aspergillus fumigatus: AFUA_2G09840Help
Entry
AFUA_2G09840      CDS       T01017                                 

Definition
folic acid synthesis protein (EC:2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
afm  Aspergillus fumigatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFUA_2G09840
Enzymes [BR:afm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AFUA_2G09840
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AFUA_2G09840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 462 aa AA seqDB search
MNQDSPLMHRAYIALGSNVGERVEMIEKACKEMERAHIRVKRTSSLFETAPMYVLDQDPF
MNGVCEVETSLGPLELLDKLQSIELALGRRKLIDKGPRSIDLDILLYDQEVFSHERLNIP
HKLMLERDFVLRPLCQLIPHELPPIPGQTRSYLSYLKSLPPPEPVPVATTHISPRFPALR
STDPKRPTHIMAILNVTPDSFSDGGKHFSQDLSALTETVRHLIAAGATIIDVGGESTRPG
SAPVGEAEELARVIPVIRHIRTSIPEANNIAISIDTYRAKVAEEACAAGADIINDISAGT
LDPEMLPTMARTGKAVILMHMRGTPATMTKLTDYPNGIVQDVGAELRARVAAAEAAGIRR
WRIILDPGLGFAKNMPHDLAILRDLQQFRTGIEGLEYLPWLMGPSRKRFIGRLTGVEKAS
ERTWGTAATVTASIAGGADIVRVHDVREMWQVAKVADAIYRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagatagtcctcttatgcaccgggcctacattgcccttgggagcaatgtgggg
gagcgggttgaaatgattgaaaaagcctgcaaggagatggaaagggcgcatatcagggtc
aagagaacaagctctctctttgagactgcgccaatgtatgttcttgatcaagaccctttc
atgaatggtgtttgtgaggtggaaaccagcttggggcctctcgaattgttggacaaactg
caatcaatcgagctggccttaggtcgaaggaaacttattgataaaggcccacgatccatt
gatctggatattctcctctatgaccaagaagtgttttcccacgagcgtctcaacatccca
cacaagttgatgctggaacgggattttgtcctacggcctctttgccagcttatccctcat
gagttgccacctattcctggacagactagaagctacctatcctacttgaagtcacttccg
cctcccgaaccagtaccagtggccaccacccacatatccccgcgtttcccagcgctgcgc
tctacagatcccaaacgtccaactcacatcatggccatcctcaacgtgacccctgattcc
ttctccgacggcggcaagcatttctcgcaggacctctccgccctcaccgagaccgtccgc
catctcatcgcagccggcgcaaccatcatcgacgtcggcggagagagtacccgcccaggt
tcagccccagtcggtgaagccgaggagctagcccgagtcatcccggtaatacgacacatc
cgcacctccatccccgaagccaacaacattgccatcagcatcgacacctaccgcgccaaa
gtagccgaggaggcctgcgctgccggcgcagacatcatcaacgatatctccgccggcacc
ctcgacccggaaatgctccccaccatggcccgcaccggcaaagccgtcatcctaatgcac
atgcgcggcacccccgccacaatgaccaagttaacagactaccccaacggcatcgtccag
gacgtcggcgccgagctccgtgcgcgcgtcgccgctgcagaagcagccggcatccgccgc
tggcgcatcatcctcgaccctggtctcggcttcgccaagaatatgcctcatgatctggcc
atcctgcgcgatctgcagcagttccgcaccggtatcgaagggctagagtacttgccctgg
ttgatggggccgagtcggaagagattcattggtcggctgacgggcgtggagaaggcgagt
gagcgcacttggggcaccgcggcgactgtcacggctagtattgctggtggagcggacatt
gtgcgtgtgcacgatgtcagggagatgtggcaggttgccaaggtggcggatgctatatac
cgtgtataa

DBGET integrated database retrieval system