KEGG   Aspergillus fumigatus: AFUA_2G10270Help
Entry
AFUA_2G10270      CDS       T01017                                 

Definition
TOR pathway phosphatidylinositol 3-kinase TorA, putative
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
afm  Aspergillus fumigatus
Brite
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AFUA_2G10270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 2384 aa AA seqDB search
MAQAGPITDITQRLFSELKSKNEETRVRASFELYDNVLAISRDWPPEKFLEFYNAVSQRI
AQLVVTGSDAHERIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDNAVLVYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQESRRFAAVLVIRELAKGSPTLLYGFVPQ
IFDLIWVALRDPKVLIRETAAEAVSECFEIIAARDAQVRQLWFARIYEEALLGLRSSNVD
SVHGSLLVLKELLLKGAMFMNEHYRNACEIVLRLKDHRDHKIRAQVVQTIPILASYAPVD
FTETYLHRFMIYLQAQLKRDKERDAAFIAIGKIANAVGAAIAQYLDGIIIYIREGLALKA
RNRAAVNEAPMFECISMLSLAVEQSLSKYMESLLDPIFACGLSESLTQALVDMAHYIPPI
KPTIQEKLLDMLSLILHGTPFRPLGCPESRLPPMPSFAKDFAPQELHSDAEIALALHTLG
SFDFSGHILNEFVRDVAINYVENDNPEIRKAAALTCCQLFVHDPIINQTSSHSIQVVSEV
IDKLLTVGIGDPDPEIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFAVREAAICII
GRLSSVNPAYVFPPLRKLLVNLLTGLGFASTARQKEESAQLISLFVSNATKLIRSYVDPM
VTTLLPKATDANPGVASTTLKAVGELASVGGAEMRNYLPRLMPIILDSLQDLSSHSKRES
ALRTLGQLASNSGYVIDPFLEYPHLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYKY
QQISEIEPDVHHINEIQTVSDVALIMQGLTPSNEEYYPTVVIHTLMQNILRENSLAQYHS
AVIDAIVTIFKTLGLKCVPFLGQIIPGFISVIRGSPPSRLESYFNQMAILVNIVRQHIRA
FLPEIIEVIQEFWDSSYQVQATILSLVEAIAKSLEGEFKKYLAAMIPSMLDTLEKDNTPR
RQPSERILHAFLIFGASGEEYMHLIIPSMVRLFERAQNPQSIRKSAIDSLTKLSRQVNVS
DFASLMIHSLARVVAGNDRTLRQAAMDCICALIFQLGQDFCHYINLLNKVLAHHQINHVN
YQILVSKLQKGDPLPQDLNPDETTGTLADESSYSDIGQKKMVVNQQHLKNAWDASQKSTR
EDWQEWIRRFSVELLKESPSPALRACASLAGIYQPLARDLFNAAFVSCWTELYDQYQEEL
VRSIEKALTSPNIPPEILQILLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKE
LEFEQDQNSGAVEALITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAA
YKRREKIDPDSFGVTMGKMRCLHALGEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWG
RGQWELMDSYLGVMKEQSPDRSFFGAILAIHRNQFDEATMYIEKARNGLDTELSALLGES
YNRAYNVVVRVQMLAELEEIITYKQNIGDPEKQESMRQTWNKRLLGCQQNVEVWQRMLKV
RALVTSPRENLDMWIKFANLCRKSNRMGLAERSLASLETVVTDNNGTRTIAPPEVTYARL
KFNWATGRQREALQMLKEFTANLTDDLNRFNALMASQSDHNGVDGVNGITEANHADMMGL
RERIGDVAKFRKLLSKSYLRQGEWQTTLQRGDWKPEHVREVLGAYSAATKYNRDSYKAWH
SWALANFEVVTTIASQTSRDGGIKPVVPGHIVTEHVIPAIGGFLRSIALSSTSSLQDTLR
LLTLWFTYGGDQEVNNVVTEGFNAVNIDTWLAVTPQLIARINQPNLKVRTAVHRLLAEVG
KAHPQALVYPLTVAMKSHITRRSQSASTIMDSMRQHSATLVEQADLVSHELIRVAVLWHE
LWHEGLEEASRLYFGDHDVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEAKHYC
MLYRETEEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLKYVSPRLKDCHDLALAVPGTYQ
SGRPIIRIISFDPILHVLQTKKRPRRMTLKGSNGSSYMYALKGHEDIRQDERVMQLFGLV
NTLLDNDGETFKRHLSVQRFPAIPLSQNSGLIGWVCNSDTLHALIKEYRESRRILLNIEH
RIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLG
VMSMVGYILGLGDRHPSNLLLERATGRVVHIDFGDCFEVAMHREKYPERVPFRLTRMLTF
AMEVSNIEGSYRITCEAVMRVIRDNKDSLMAVLEAFIHDPLINWRLNIRESPERPPFSTE
RRQSITSVMNLEHGVQPSNFSRHRRPSILDGGILDVQEGIPPEAREAQNARAVQVLARVK
EKLTGRDFKPTEELNVSDQVDKLLAQATSVENICQHWIGWCSFW
NT seq 7155 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcaggtcctattacggacatcactcagcgactcttcagtgaattgaagtcc
aagaatgaggagacgcgggtaagagcttcatttgagctctatgataacgtcctggctatc
tcgagagattggcctccagagaagttcctcgaattctataacgctgtcagtcaacgcatc
gcgcagctcgtggtcaccggcagtgacgcacatgaacggatcggcggccttttggctctc
gatcgcttgattgatttcgatggtgtcgatgcggctcagaaaaccactcgattcgctagt
tatttgcgcagcgccttgcgcagcaacgacaatgcagtgttggtctatgcagctcgatct
ttgggacgtttggcgaagccgggcggcgctcttactgcagaattggtcgaaagcgagatt
caatcagcattagaatggcttcagtctgaacgacaggaaagtaggcgcttcgctgctgta
cttgtcataagagagcttgccaaaggctcgccaactcttctttacggcttcgttccacag
atcttcgacctcatttgggtcgctctgcgggaccccaaggtccttatccgagaaacagcc
gcggaagcggtctctgagtgtttcgagattatagccgccagagacgctcaagtccgacaa
ttgtggtttgcaagaatatacgaggaagcacttctgggccttaggtcaagcaacgtggac
tcggtacatggatcgctcttagtactcaaggagcttctcctcaaaggagccatgttcatg
aacgagcattatcggaatgcatgtgagattgttctccgtttgaaggatcaccgtgaccat
aagatccgggcccaagttgtccagacgattcctatacttgcctcgtacgcccctgtcgac
tttacagaaacatacctacataggttcatgatctacctgcaggcgcaattgaagagagac
aaggaacgagacgcagcattcatagcgattggaaaaattgccaatgctgttggtgctgcc
atcgcacagtatcttgatggaattattatctacatacgcgaaggattggccctgaaagct
cgaaatcgagctgctgtaaatgaagcaccaatgtttgagtgcatcagcatgctctctttg
gctgtcgagcagtcgctcagtaaatacatggaatctttacttgaccctatatttgcatgc
gggttgagcgagtcgctgacgcaagcacttgtcgacatggctcactatatcccccctatt
aaacctaccattcaggagaagctcctggatatgcttagcctgatccttcatgggacaccc
ttccgtcccctcggttgcccagagagcaggctacctcccatgccgtctttcgcaaaggac
ttcgctccacaagagttgcactctgatgcagagatcgctctggcccttcataccctgggg
agctttgatttctccggccacattctcaatgaatttgtgcgcgatgtggccattaattac
gtcgagaacgacaaccctgagattcggaaggctgcagcgctcacctgctgccagcttttt
gtccatgatccgatcatcaaccagacaagcagtcattccatacaggttgtcagtgaggtt
attgataaattattgactgtcgggatcggtgacccagacccagagatccgacgtaccgta
ctatggtcactggaccgcaaattcgatcgtcatctggcgagaccagagaacatccgctgc
ctgttcttggccgtaaatgacgaagtatttgccgttcgggaagctgcaatttgcatcatt
ggccgcctttcgagcgtcaacccagcctacgtgttcccgccactacgaaaattgctcgtg
aaccttctgacagggcttgggttcgcgagcacagcccgacagaaggaggagagtgctcag
ctcatcagcctatttgtatcaaatgcgaccaaacttattaggtcgtatgtcgatcctatg
gtgacaaccttacttccgaaggcgacggatgccaacccaggtgtcgcctcgaccacactg
aaagctgtcggagaacttgcgagtgtcgggggcgcggaaatgagaaactacctcccgcgg
ctgatgccaattatactggactctttgcaggatctctcttcgcattctaagcgagagtcg
gctttgcggacgctgggccaattggccagcaactctggctatgtcattgatccgtttctc
gaatatcctcatttacttgccgtgctcataaatatcatcaagactgagcaaactgggtcg
ctgcgcaaagagacaatcaaattactggggattcttggtgctcttgatccgtacaagtac
caacagatcagtgaaatcgaacccgatgtccaccatatcaacgaaattcagactgtttct
gatgttgccctcataatgcagggcctcacgccttccaacgaggagtattatccaaccgtt
gtcatccataccttaatgcagaatatcttgcgtgagaattctcttgctcagtaccactct
gcggtcattgatgcgattgttacaatcttcaaaactctgggtttgaagtgcgtgcctttc
ttagggcagatcattcccggcttcatatcggtcatccgaggttcgccgcctagccgccta
gaatcctacttcaatcagatggctatcttggtgaatattgttcgacagcatattcgagct
ttccttccagagattatcgaggtcatccaggaattttgggattcatcgtaccaagtgcaa
gcgactatcttgtcacttgttgaagcaatagccaagtctctggagggtgagttcaaaaag
tacctggcagccatgattccttcaatgttggacactcttgagaaggacaacacgcctcgc
cgccagccttctgagagaattctccacgcgttcctcatctttggcgccagtggggaagag
tacatgcatctaatcatcccatctatggtacggctctttgagagagcccagaatcctcaa
agtatcaggaaatcagccatcgatagtctcacaaagctgtcgcgacaagtaaatgtttct
gactttgcatctttgatgattcactcattggctcgggttgttgcaggcaacgaccggacc
ttaagacaagcagcgatggactgtatctgtgctcttatcttccagctcggccaggatttc
tgccactacataaatctcctgaacaaggtcttggcgcatcaccagatcaatcatgtcaat
taccagattctagtttccaagctccaaaagggcgatccgctgccacaggacttgaatccc
gatgagactacgggtacactggcggatgaatctagttattctgacattggccagaagaag
atggttgtgaatcagcaacatctgaagaatgcttgggatgcctctcaaaagtcgacgcgt
gaagactggcaggaatggatacgaagattcagcgtggagctattaaaagagtcaccctca
ccagcacttcgagcatgcgccagtttggctggtatctaccagccattagcaagggacctc
tttaacgcagcatttgtatcctgctggacagagctgtacgatcagtatcaagaagagctc
gtacgctcaattgagaaggctcttacttcacccaatatccctcccgagatactccagata
cttctcaatcttgctgagttcatggagcatgatgataaggctcttcccattgatattcgt
acacttggcaagtacgccgcaaagtgtcatgcatttgccaaagcactccattataaagag
ctggaattcgagcaagaccaaaactccggcgccgtggaggctctgatcaccattaacaac
cagcttcagcagtctgacgccgctattggtattcttcgcaaagcccaagcctacagggat
gtagagctgaaagagacatggtttgagaaacttcagcgatgggaagaggcacttgccgct
tacaaacgccgtgagaaaattgatccagactcttttggtgtcactatgggcaagatgcgg
tgtctgcatgcgcttggcgagtggaaggtattgtctgatcttgcccaagagaagtggaac
caggcttctctagaacatcgcagagccattgctcccctagcagcagcagcagcatgggga
cgaggccagtgggagctgatggattcctacttaggcgtgatgaaagagcagtccccggat
aggtctttcttcggtgcaattctcgcgatccatcgaaatcaatttgatgaggcgacaatg
tacatcgagaaagcccggaacggcctcgacacagaactatcagctttacttggagagtca
tataaccgtgcctacaacgttgtcgttcgtgttcagatgcttgctgaattagaggagatc
atcacttacaaacagaacattggggaccctgagaaacaggagtcaatgcgtcagacatgg
aataagaggttgctcggctgccaacagaacgttgaagtatggcaacgcatgctcaaggtc
agggcgctcgtcacttcaccgcgcgaaaaccttgatatgtggatcaaatttgccaacctc
tgccgtaaatccaatcgcatgggacttgccgagcgatcactcgcatctttggagactgtt
gtcactgacaacaatggtacaagaactatcgctcctcccgaagtgacctacgctcgcttg
aaatttaattgggctactggtcgccagcgtgaagctcttcagatgctaaaagagttcact
gcaaatctgacggatgatttgaatcgctttaatgcgctcatggcatcacagtccgatcat
aacggagttgatggcgtcaacggaatcacagaggcaaatcatgcggatatgatgggtctc
cgtgaacgtattggcgatgtagccaagttccgcaagctgctttctaagagttatcttagg
cagggagagtggcagacaactttgcaacgaggcgactggaagcccgaacacgttcgcgag
gttctcggcgcatattctgctgccacgaaatacaaccgcgattcgtacaaagcctggcat
tcctgggctttggccaacttcgaagtcgtgacaacgattgccagtcagacaagcagggac
gggggtatcaagcccgtagtccctggccatattgtgacagagcatgtcatacctgccatt
ggaggcttcctcagatcaatcgctttgtcatccacctcgtcgctccaggatactctgaga
ctgctgaccctttggttcacttatggcggtgaccaagaggtcaataatgttgtcacagaa
ggcttcaatgcagtgaacattgacacctggcttgcggtaactccacaactcatcgcccgt
ataaatcagccaaacctcaaggtccgaaccgctgttcatcgcctcctggccgaagtgggc
aaggcccatccgcaagcgctggtgtacccattaaccgttgcgatgaaatcgcacattacc
cgccgttcgcaatccgccagcactattatggatagtatgcggcagcacagtgctacttta
gtcgagcaggccgatctcgtcagccatgaattgattcgagtcgcggttctgtggcacgaa
ctctggcatgaagggttggaggaagcctctagactttacttcggtgaccatgatgtggag
ggaatgttcgcaactcttgcgccactgcatgacatgcttgacaagggtgcggaaacgctc
cgtgaggtttcttttgcgcaggcgtttggacgggatcttgcagaggcgaaacactattgt
atgctgtatcgtgagacggaagaaatcggcgatctcaaccaagcttgggatctctactat
actgtattccgcaagatcagccggcagctcccacagttatcgactcttgacctcaaatat
gtctctcccaggctcaaggactgtcatgaccttgctcttgctgttcccggaacctaccaa
agtggcagaccaatcatccggatcatcagctttgatcctatattgcacgtgcttcaaact
aagaagcgacctcgacgcatgactctgaagggaagcaatggaagctcttacatgtatgcc
cttaagggacatgaggacattcggcaagatgagcgagtcatgcagttgttcggactcgtg
aacactttgcttgataacgatggcgaaaccttcaagcgacatctttccgttcagcgtttc
cctgccatccccttgtctcagaactctggtctgataggatgggtctgcaacagcgataca
ttacatgcgctgatcaaggagtaccgtgaaagtcgccgcatcctactcaatatcgaacat
cgtattatgctgcagatggcgccagattatgacaatctcactctgatgcaaaaggttgag
gtcttcggatacgccatggacaacactactggaaaggatctgtatcgtgttctgtggctc
aaaagtaagagttccgaggcctggcttgagcgtaggacgaattatacaagatctttggga
gtcatgtcgatggtgggctatattctgggcctgggtgaccgtcatccgtccaaccttctg
ctggagcgcgccacaggaagagtcgttcatatcgatttcggtgactgcttcgaggtggcg
atgcaccgtgagaaatatccagagagggtgcccttccggttaactcgcatgttgaccttc
gccatggaagtcagcaatattgagggaagctaccgtatcacttgcgaggctgttatgcgc
gtgatcagagacaacaaggattcccttatggccgttctggaagcattcattcacgatccc
ttgatcaactggcgtctgaacattcgcgagtcaccagaacggccgccgttcagcactgag
cgccgacagtccattacgtccgttatgaatcttgaacatggcgttcagcccagcaatttc
tcccgtcaccgtcgcccatctatcctcgacggtggtatcctcgatgtccaggagggcatt
ccgcccgaagcccgtgaggcacagaatgcacgagcggtgcaggtgcttgctcgggtcaag
gagaagctcacaggtagagacttcaagcccactgaagagctcaatgtgagcgatcaagtg
gacaaacttctcgcgcaggcaacgagtgtggagaacatatgtcagcattggattggatgg
tgtagtttctggtga

DBGET integrated database retrieval system