KEGG   Aspergillus fumigatus: AFUA_2G10590Help
Entry
AFUA_2G10590      CDS       T01017                                 

Definition
disulfide isomerase (EC:5.3.4.1)
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
afm  Aspergillus fumigatus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AFUA_2G10590
Enzymes [BR:afm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AFUA_2G10590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 737 aa AA seqDB search
MRSSLLAWSFLSLLSIPTFAIPSGGIANDLNLANNRLVKRAEPVEKTESEPVSTTFNGVE
VPPLKELTPENFEELTKNGYWFVKHYSPSCPHCKAIAPTWQTLYEYYYTSKPISSSSEPS
DTQSLNSFQNFYNFHFASMNCLAFSDFCKRLDVKWFPTFSLYHNGKLIEQFEGAKTMEGL
SEFIEGKLESIRPGSRPPKGVKLPKPGDKQVDTEAAPDVPAAKDKDRVAGVKAGEKHNEQ
VAQLASAEAPVKSATPKVNSKPSAPANPQGISVPLTAESFQKLVTTTRDPWFVKFYAPWC
HHCQALAPVWQGMAREMQHVLNVGEVNCDAEPRLCKDARVNAYPTMYFFRGGERVEYTGL
RGLGDLVNYAKKAVDIGSGVQDVDAAQFKQLEEKEEVIFLYFYDHATTSEDFEALERLTL
SLVGHARLVKTSSAALAERFKITTWPRLLVSRDGRPSYYNALAPKDMRDVRQILNWMRSV
WLPIVPELTVSNAREIMDGKYVVLGILSRRRSDDFILAKRELKSAALEWMDKQTQLFRLE
RQELRDAKQLRIEEAEDRNDQRALRAAKNMRISIREDDKKQVGFAWVDGEFWERWLRTTF
GIDIENGERVIINDQDNRRYWDATSSGAPIMASRTSILETIPLVIADSSKLKPKSTVGTF
EYIFFVTRSFISGHPIIFVALLTISIVAVTYLARARLAKRGLSRGGILGAVQSNSAGFFR
LDGKEGLLNGGGTGKVD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcctctttgctggcgtggtcgttcctttcgcttctctctatcccaacttttgcc
attccttccggcggcatcgcgaatgatcttaatcttgcgaacaatcgcctcgtcaaaaga
gcggaaccggttgaaaagactgagtcggagccggtgtcgacaacattcaatggcgtcgaa
gtgccgcccctgaaagagttgacaccagagaactttgaggagcttaccaaaaacggttac
tggtttgtgaagcactattctccgtcatgtccccattgcaaggcgatcgctcccacatgg
cagactctatacgaatactactatacatctaaaccgatatcttcctcttccgagccgtct
gatactcaatcccttaactccttccaaaatttctacaactttcacttcgcttcgatgaac
tgtcttgcattttcggatttctgcaagaggctggatgtcaaatggtttccgacattttcc
ctttaccataatggcaaattgattgaacagttcgagggtgcgaagaccatggaaggtcta
agtgagttcattgaaggcaagctagaatcaatccgacctggttctcgtcctccgaagggc
gtaaagcttcccaaaccgggcgacaaacaggtagacacggaagctgcgccggacgttcca
gccgccaaggacaaggaccgtgtggcgggagtcaaggctggtgagaagcataatgaacaa
gtcgctcagctcgccagcgcagaggctccggtgaaatctgctacccctaaggtgaactcg
aaaccatccgcgcctgcgaaccctcaaggtatctccgttcctcttacagcagagagcttt
caaaagctggtcacaactaccagagatccctggttcgtcaagttctatgctccgtggtgc
catcactgccaagcactggcgcctgtttggcagggaatggcccgggagatgcagcatgtc
ctcaacgttggagaggtgaattgcgatgcagagcccaggctttgcaaggacgctcgggtg
aacgcctacccgacaatgtacttcttccgtggtggcgaacgcgttgaatacaccggttta
cgcggtcttggcgatttggtcaactacgcaaagaaggctgtagacattggatctggtgtt
caagatgtcgacgcagctcaattcaagcagctggaagaaaaggaagaagtgatatttctg
tacttttacgaccacgcaacgacatctgaagattttgaggccttggaacgtttgactctc
agcctggtgggtcacgccagattggtcaagacaagcagtgcggctctcgccgagcggttc
aagatcacaacctggcctcgtctcttagtctcccgagatggacgtcccagttactataat
gctctggctcccaaggatatgcgggacgtccgccagattctgaactggatgcgctctgtt
tggctgcctattgtccctgaactcacggtctctaacgcccgcgagatcatggacgggaaa
tatgttgttcttgggattctgagcaggcgtcgctcggatgatttcatccttgccaagaga
gaattaaagagcgccgctctggagtggatggacaaacaaacccagttgttccgattggag
aggcaagaacttagggatgctaagcagctacgtatcgaggaggcagaagaccgcaatgac
caacgtgccttgcgggctgctaagaacatgcgcatttccatccgggaagatgacaagaag
caagttggatttgcctgggttgatggcgagttctgggaacggtggctgaggaccactttt
ggtatcgatatcgagaacggagaacgggtcatcattaacgaccaggataatcgacgctac
tgggacgccacttctagtggagctccgatcatggcctcgcgaacctccatcctcgaaacg
attccgctagtcatcgccgactcgtcgaagttgaagcctaagtccacagtcggaacattc
gaatacatcttcttcgtcactcggtcctttatttccggccatcccatcattttcgtcgca
ttgttgaccataagcattgttgccgtcacttacttggctcgagcaaggctggcaaaacgt
ggcctcagtcgtggtggcatcctcggcgcggttcagagcaatagtgccggctttttccgt
ctcgatgggaaggaaggtctactgaatgggggcggcaccggaaaggtcgattag

DBGET integrated database retrieval system