KEGG   Aspergillus fumigatus: AFUA_2G10920Help
Entry
AFUA_2G10920      CDS       T01017                                 

Definition
enoyl-CoA hydratase/isomerase family protein (EC:4.2.1.55)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
afm  Aspergillus fumigatus
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFUA_2G10920
   01212 Fatty acid metabolism
    AFUA_2G10920
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AFUA_2G10920
   00650 Butanoate metabolism
    AFUA_2G10920
  Lipid metabolism
   00062 Fatty acid elongation
    AFUA_2G10920
   00071 Fatty acid degradation
    AFUA_2G10920
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFUA_2G10920
   00310 Lysine degradation
    AFUA_2G10920
   00380 Tryptophan metabolism
    AFUA_2G10920
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFUA_2G10920
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AFUA_2G10920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 294 aa AA seqDB search
MFSRQCSRLVASRTTIPLTSYLSRVARPYSSAASMYEYIITSTPKPGVGLITLNRPKALN
ALSSPLFKELNDALSKYEEDKDIGAVVITGSEKAFAAGADIKEMAPLTFSNAYTNNFIAP
WSHLANSVRKPVIAAVSGYALGGGCELALMCDIIYCTASATFGQPEIKLGVIPGAGGSQR
LTHAVGKSKAMELILTGKNFSGKEAEQWGVAAKAVEGGHEELLAEALKTAETIAGYSRVS
VLAAKEVVNKSQELSLREGVEYERRLFHGLFGSKDQKIGMTAFAEKKKPEWSHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcggcaatgttcccgcctggtcgcgtccaggaccactatccctctgacatcc
taccttagccgtgttgccagaccgtactcatctgctgcctcgatgtacgaatacatcatc
acgtcgactcctaagcctggtgttgggctgatcaccctcaaccgccccaaggcactcaac
gccctctccagcccgctcttcaaggaactcaacgatgcactatctaagtatgaggaagat
aaagacattggggccgtcgtcatcacaggcagcgaaaaggcctttgccgccggcgccgac
atcaaggaaatggccccactgaccttctccaacgcttacaccaacaacttcatcgccccg
tggtcgcacctcgccaactccgtccgcaagcccgtcatcgccgccgtctccggctacgcc
ctcggcggcggctgcgagctcgccctcatgtgcgacatcatctactgcaccgctagcgcc
accttcgggcagcccgagatcaagctgggagtgatccccggcgcgggcggttcgcagcgt
ctcacccacgccgtcggcaagagcaaggcgatggagctgatcctgacggggaagaacttc
agcggcaaggaggcggagcagtggggtgttgcggccaaggctgtcgagggtgggcatgag
gagctactggctgaggcgcttaagactgcagagacaattgcgggatatagtcgggtgagt
gttctggctgccaaggaggtggtgaataaaagccaggagctttcgctccgggagggcgtg
gagtatgagaggcggctgttccatggattgtttggaagcaaggatcagaagattggaatg
actgcgtttgctgagaagaagaagcccgagtggtctcatgagtag

DBGET integrated database retrieval system