KEGG   Aspergillus fumigatus: AFUA_2G11900Help
Entry
AFUA_2G11900      CDS       T01017                                 

Definition
pyruvate dehydrogenase kinase (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     AFUA_2G11900
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   AFUA_2G11900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 434 aa AA seqDB search
MWKPSERLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEEIINLPRPTLSQEVKARLLRPGKMSGGFSKILS
ETTQNPSIKEGQYRSSPTNGNGNGKGHVSRRYFYPSDDQGHWPPELNDYNQRFAKTLQHI
KRRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIALTEQTH
VRHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPKIQLICKDDLNFMYVPGHL
SHMLFETLKNSLRAVVETHGADKEAFPVTKVIVAEGKEDITIKISDEGGGIPRSSIPLVW
TYMYTTVDQTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVY
LHLNRLSSSSEPLQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccgtcggagagactgatggaaaccatcagacactatgcgagcttccccgcc
acaggtgtctctctccggcagatggtccagttcggtgacaggccatcgacaggaaccctc
tttcgtgcctcccaatttctatccgaagagttacctattcgcttagcacatcgtgttcag
gatctgggagaacttcctgatggattgagtgaaatgccctcgatcaagaaggtgcaggac
tggtatgcgcagtcgttcgaggaaatcatcaacctgccccgaccaactctttctcaagaa
gtcaaagctcgccttttacggcctgggaagatgagtggcggcttttcaaagattctttct
gaaactacacaaaaccccagcatcaaggaggggcagtatcggtcgtcccccacgaacggg
aatgggaacgggaagggacatgtcagccgaagatacttctacccatccgatgaccagggc
cattggccacccgagttgaacgactacaaccaacggtttgcgaagacgctgcagcatatc
aaacggcgacacgacagcgtcgtgaccaccgtagcccagggcattttggaatggaagcgg
aaacgccaacgtttacaaattgattccaccgtccaatcgttcctagatcgcttttatatg
tcccgtattggtatacgaatgttaatcggtcaacacatcgccctgacggaacagacgcat
gttcgccacccgaactacgtcggtatcatctgcaccaagacaaatgtccgagaagtcgcc
ctcgaggccattgacaatgctcgtttcgtctgtgaggactactatggtcttttcgaagca
ccgaagattcagctcatctgcaaggacgacctcaacttcatgtacgttcccggtcacctg
tcacacatgctctttgagactcttaagaattcgctgcgtgctgtggtggagacccacggc
gcggacaaggaagcattccctgtgacaaaggtcattgtggcagaaggaaaagaggacatc
accatcaaaatctccgatgaaggtggtggcataccccgttcttccatcccgttggtgtgg
acgtacatgtacactaccgtggatcaaacgcccaatctggatccggatttcgataagaac
gacttcaaggctcccatggctggctttgggtacggattgccaatcagtcgcttgtatgct
cggtactttggtggtgatctcaagttgatcagtatggaaggatatggcacagacgtctat
ctccatctgaatcggctctcttcgagctcggagcccctgcaatga

DBGET integrated database retrieval system