KEGG   Aspergillus fumigatus: AFUA_2G12200Help
Entry
AFUA_2G12200      CDS       T01017                                 

Definition
cAMP-dependent protein kinase catalytic subunit PkaC1 (EC:2.7.11.1)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
afm  Aspergillus fumigatus
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:afm04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 490 aa AA seqDB search
MPTLGGLLKKRRTKDSHTLSKELESSSSPAAAQTQTSPNSADHDHHYQHYDQTHHHQHSA
SSNPSNNSATPSAAQPHRSSNDNPNRSSGTDQKSEGQTASMQFAVTQPHPSTHHNPRLHH
LQQQQQQPQQQSHTSRLHNILHPSHHASSQASTEGHAHSQQANQTEARTTKGKYSLDDFT
IQRTLGTGSFGRVHLVQSKHNHRFYAIKVLKKAQVVKMKQVEHTNDERRMLNRVRHPFLI
TLWGTWQDARNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQQIIY
RDLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSL
GILIFEMLCGFTPFWDSGSPVKIYENILRGRVKYPPYLHPDAVDLLSQLITADLTKRLGN
LHGGSEDVKNHPWFAEVTWDRLARKDIDAPYVPPIRGGQGDASQYDRYPEETEQYGQQGE
DVHGHLFPDF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgccgactttaggaggtctcttgaagaaacggcggacaaaggattcgcataccctctct
aaagaactggaatcaagttcgtcacccgcagcagcccagacacagacgtcacccaactct
gccgaccacgaccaccactaccagcactacgatcaaacccaccatcatcaacattcggcc
agcagtaaccccagcaataattccgcaactccctctgctgctcagcctcatcgctcatcc
aacgacaaccccaatcgctcttcaggtacagatcaaaaatccgagggtcaaactgcctcc
atgcaattcgccgtgacgcaaccccatccctccacccaccacaacccgcgcctccaccac
ctacaacaacagcaacaacagccacaacaacaatcccatacctccaggttacacaatata
cttcacccctctcatcatgcgtcttcacaggcttctaccgaaggtcatgcacactcccag
caggccaatcagactgaagcccgcactacgaaagggaaatattccctagacgatttcacc
atacaacgtactctaggtactggtagtttcggtcgtgtccatttggtgcagtcgaaacac
aatcatcgcttctatgcgatcaaggttctgaagaaggcgcaggtggtcaaaatgaaacag
gtcgagcatacgaatgacgagcgacgaatgctcaatcgtgtcaggcatccattcctgatc
acattgtggggtacctggcaagatgcaaggaatctgtacatggtaatggactttgtggag
ggcggagagctctttagtttacttcgcaaatctcagcggttcccaaaccctgtcgccaag
ttttatgcggccgaggtgactcttgcactggagtatctacactctcagcagattatctac
cgggacctgaagcctgagaatctgctgctggaccggcacggccacctgaagatcaccgat
tttgggttcgcgaaggaggtacctgatatcacatggactctttgcggaacgcccgattat
cttgctccagaagttgtttcgtccaagggatataacaaatcggttgattggtggtcactt
ggaattcttatcttcgaaatgttgtgcggcttcacacccttctgggacagtggctcgccc
gtcaagatctacgagaacattctccgcggccgtgtcaagtacccgccctatcttcaccca
gacgccgtcgacttgctctcgcagctcatcacagcggatttgacaaagcgactgggcaac
cttcatggaggttccgaagatgtgaagaaccacccttggtttgcggaagtcacctgggat
cgtcttgcaagaaaggacattgatgctccttatgttcctcctatccgtggaggtcagggt
gatgccagccaatacgatcggtatcccgaggagactgaacaatacggtcagcagggcgaa
gatgtgcatggccatcttttcccagacttctag

DBGET integrated database retrieval system