KEGG   Aspergillus fumigatus: AFUA_2G13110Help
Entry
AFUA_2G13110      CDS       T01017                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
afm  Aspergillus fumigatus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AFUA_2G13110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 235 aa AA seqDB search
MGKEEGFAPGKHTLIFPFLQCPRFTLIGTCHHSLRNCGVFSWYRNRRISSSQFKIFSNRC
LPFPRDAKKGAKLFQTRCAQCHTVESGGPHKVGPNLHGLFGRKTGSAEGYAYTDANKQAG
VTWDENTLFSYLENPKKFIPGTKMAFGGLKKAKERNDLITYVFLSKTHSTMVGIAGANFF
SPTATSRRTAKHVRPEKSLVSSTLSGKLCRADSPVVKADARHVHRTRHVLYYNLD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaggaaggtttcgctcctggtaagcataccttgatcttccctttcttgcag
tgtcctcgtttcactctaattggaacctgccatcattcactgcgaaactgcggcgtcttc
tcctggtatcgcaatcgtcgcatctcgtcgtcacagttcaaaattttctcaaaccggtgt
ctaccattcccacgtgacgctaagaagggtgccaagctcttccagacccgttgcgctcag
tgccacactgtcgagtctggcggtccccacaaggttggccccaacctccacggtctcttc
ggccgtaagaccggttccgccgagggatacgcctacaccgacgccaacaagcaggccggt
gttacctgggacgagaacactctgttctcctaccttgagaaccccaagaagttcatcccc
ggtaccaagatggccttcggtggtctgaagaaggccaaggaaaggaacgacctgatcacg
tatgtgtttttgtcgaagactcactctaccatggttggcattgcaggcgctaactttttc
tctcctacagctacctcaaggagaactgctaaacatgttcgccctgaaaagtcacttgtc
tcttcaaccttgtctgggaaactttgtcgcgccgattctcctgtggtaaaagcagatgcg
cggcacgttcaccggacacggcatgtactatactacaaccttgattaa

DBGET integrated database retrieval system