KEGG   Aspergillus fumigatus: AFUA_2G13250Help
Entry
AFUA_2G13250      CDS       T01017                                 

Definition
bifunctional tryptophan synthase TRPB (EC:4.2.1.20)
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
afm  Aspergillus fumigatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFUA_2G13250
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFUA_2G13250
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFUA_2G13250
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFUA_2G13250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 735 aa AA seqDB search
MEGIKSTFARCQEQKRAALVAYITAGYPTVEETVDILLGLENGGAGSLNANAIRWISTDI
IELGIPFTDPIADGPTIQRANTQALANGVTVTTVLNMVRQARSRGLKAPLLLMGYYNPVL
RYGEERMLKDCKEAGVNGFIMVDLPPEEAVRFRDLCASNGMSYVPLIAPATSEARMKLLC
KIADSFIYVVSRMGVTGATGKLSSNLPELLKRVHQWSGNVPAALGFGVSTREHFLSVQEL
AEGVVIGSQIITVLGQAPAGQAAKHAEEYLSSVTGRKLERDAQGILTNEINVLEAVEKAQ
VPAVSQPTAVVTEADTPDGPGLADQIDALNGTGNPAAQPSRFGEFGGQYVPESLMDCLAE
LERGFQEAVNDPTFWEEFRSYYPYMGRPSSLHLANRLTEYVGGANIWLKREDLNHTGSHK
INNALGQILIARRLGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAEDVRRQALNVF
RMKLLGASVVAVDAGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSV
IGEETKQQMMEAIGKLPDAVVACVGGGSNAVGMFYPFAKDTSVKLVGVEAGGDGIDTNRH
SATLTGGSKGVLHGVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDSDRARFIAA
TDAEALIGFRTLAQTEGIIPALESSHAVWGAMELAKSMKTGDIVLNLSGRGDKDVQSVAD
ELPRLGPKIGWDLRF
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatcaagagcacttttgccaggtgccaagaacagaagcgcgcagcactcgta
gcgtacatcacagccggctatcccaccgtcgaggagacagttgacattcttctggggcta
gaaaatggaggcgcaggaagcctcaatgctaacgcaatccgttggatttcgacagatatc
atcgaactgggcattcccttcacagatcccatcgcagatggccccaccattcagagggcc
aacacccaggctctggccaatggcgtcacggtcaccacagtgctgaacatggtccgtcaa
gctagaagcagaggcctcaaggccccgttgcttctgatgggctactataaccctgtcttg
cggtacggtgaggagcgtatgctcaaggattgtaaggaggccggtgtcaatgggttcatc
atggtcgatcttcctcccgaagaggcggtgcggttcagagatctgtgtgctagcaatggt
atgtcctatgtcccgctgatcgctcctgctacctccgaggcccgcatgaagctgctctgc
aagatcgccgattctttcatctacgtcgtttcgagaatgggcgtcaccggcgcgacggga
aagctgagctcgaacctccccgaactgctgaagcgcgttcaccagtggtcgggtaacgtg
cccgctgctctgggcttcggtgtcagcacccgtgagcacttcttgagtgtgcaggagctc
gccgagggtgttgtcattggaagtcagattatcactgtcctgggccaggcccctgccggt
caggcggctaagcacgccgaggagtacttgtcgagtgtcactggccgcaagctcgagaga
gatgcacagggtatcctgactaatgagatcaacgtgttggaggccgtggagaaggcccag
gtaccggctgtctcgcagcctaccgctgttgttaccgaggccgatactcctgacggtcct
ggattggccgaccagatcgacgccctcaatggaactggtaatcctgctgctcagccatcg
cgcttcggtgaatttggtggacagtacgtccccgaatctctcatggactgcttggccgag
ctcgagcgcggcttccaagaagctgtgaatgaccccacgttctgggaggagttccgctct
tactacccatacatgggtagacccagcagcctgcatctggccaatcgcctcacggagtat
gtagggggtgccaacatctggctcaagcgcgaggatctcaaccatactggcagtcacaaa
atcaacaacgctctcggtcagattctcatcgctcggagactgggcaaaaccagaattatt
gctgaaaccggtgctggacaacacggtgtcgccacagccactgtatgtgcgaagttcggc
atgaagtgtgtggtgtacatgggtgctgaggatgtccgccgtcaagccctaaatgtcttc
cggatgaagctccttggagcctcggtcgtggccgtcgatgccggaagcaggactctgcgt
gatgctgtcaacgaggcccttcgtgcctgggttgttgacctggacaccacccactacatt
atcggctccgccattggacctcaccccttccccaccatcgtgcgtaccttccagtccgtc
atcggcgaggaaaccaagcagcagatgatggaggccatcggcaaactccccgatgccgtc
gtcgcttgtgtcggcggtggcagtaatgccgtcggcatgttctaccccttcgccaaagac
actagcgtcaagctggtcggtgtcgaggccggaggcgacggtatcgacacaaacagacac
tcggcgaccctgaccggcggcagcaagggcgtgctgcacggtgttcgcacgtacgtcctc
caggacgaacacggccagatctccgagacccactccatctcggccggcctggactacccc
ggtgtcggccccgagctcagctcgtggaaggacagcgaccgcgcccgcttcatcgctgcc
accgacgccgaagccctgatcggcttccgcaccctcgcgcagaccgagggcatcatcccc
gccctggagtcctcgcacgccgtctggggcgccatggaactcgccaagtccatgaagaca
ggcgacatcgtcctgaacctgagcggccgaggagataaagacgtccagagcgtcgcggac
gaactaccccgcctgggtcccaagatcggctgggacctgcgattctaa

DBGET integrated database retrieval system