KEGG   Aspergillus fumigatus: AFUA_2G13250Help
Entry
AFUA_2G13250      CDS       T01017                                 

Definition
(RefSeq) bifunctional tryptophan synthase TRPB (EC:4.2.1.20)
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
afm  Aspergillus fumigatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFUA_2G13250
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFUA_2G13250
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFUA_2G13250
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFUA_2G13250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 735 aa AA seqDB search
MEGIKSTFARCQEQKRAALVAYITAGYPTVEETVDILLGLENGGAGSLNANAIRWISTDI
IELGIPFTDPIADGPTIQRANTQALANGVTVTTVLNMVRQARSRGLKAPLLLMGYYNPVL
RYGEERMLKDCKEAGVNGFIMVDLPPEEAVRFRDLCASNGMSYVPLIAPATSEARMKLLC
KIADSFIYVVSRMGVTGATGKLSSNLPELLKRVHQWSGNVPAALGFGVSTREHFLSVQEL
AEGVVIGSQIITVLGQAPAGQAAKHAEEYLSSVTGRKLERDAQGILTNEINVLEAVEKAQ
VPAVSQPTAVVTEADTPDGPGLADQIDALNGTGNPAAQPSRFGEFGGQYVPESLMDCLAE
LERGFQEAVNDPTFWEEFRSYYPYMGRPSSLHLANRLTEYVGGANIWLKREDLNHTGSHK
INNALGQILIARRLGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAEDVRRQALNVF
RMKLLGASVVAVDAGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSV
IGEETKQQMMEAIGKLPDAVVACVGGGSNAVGMFYPFAKDTSVKLVGVEAGGDGIDTNRH
SATLTGGSKGVLHGVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDSDRARFIAA
TDAEALIGFRTLAQTEGIIPALESSHAVWGAMELAKSMKTGDIVLNLSGRGDKDVQSVAD
ELPRLGPKIGWDLRF
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatcaagagcacttttgccaggtgccaagaacagaagcgcgcagcactcgta
gcgtacatcacagccggctatcccaccgtcgaggagacagttgacattcttctggggcta
gaaaatggaggcgcaggaagcctcaatgctaacgcaatccgttggatttcgacagatatc
atcgaactgggcattcccttcacagatcccatcgcagatggccccaccattcagagggcc
aacacccaggctctggccaatggcgtcacggtcaccacagtgctgaacatggtccgtcaa
gctagaagcagaggcctcaaggccccgttgcttctgatgggctactataaccctgtcttg
cggtacggtgaggagcgtatgctcaaggattgtaaggaggccggtgtcaatgggttcatc
atggtcgatcttcctcccgaagaggcggtgcggttcagagatctgtgtgctagcaatggt
atgtcctatgtcccgctgatcgctcctgctacctccgaggcccgcatgaagctgctctgc
aagatcgccgattctttcatctacgtcgtttcgagaatgggcgtcaccggcgcgacggga
aagctgagctcgaacctccccgaactgctgaagcgcgttcaccagtggtcgggtaacgtg
cccgctgctctgggcttcggtgtcagcacccgtgagcacttcttgagtgtgcaggagctc
gccgagggtgttgtcattggaagtcagattatcactgtcctgggccaggcccctgccggt
caggcggctaagcacgccgaggagtacttgtcgagtgtcactggccgcaagctcgagaga
gatgcacagggtatcctgactaatgagatcaacgtgttggaggccgtggagaaggcccag
gtaccggctgtctcgcagcctaccgctgttgttaccgaggccgatactcctgacggtcct
ggattggccgaccagatcgacgccctcaatggaactggtaatcctgctgctcagccatcg
cgcttcggtgaatttggtggacagtacgtccccgaatctctcatggactgcttggccgag
ctcgagcgcggcttccaagaagctgtgaatgaccccacgttctgggaggagttccgctct
tactacccatacatgggtagacccagcagcctgcatctggccaatcgcctcacggagtat
gtagggggtgccaacatctggctcaagcgcgaggatctcaaccatactggcagtcacaaa
atcaacaacgctctcggtcagattctcatcgctcggagactgggcaaaaccagaattatt
gctgaaaccggtgctggacaacacggtgtcgccacagccactgtatgtgcgaagttcggc
atgaagtgtgtggtgtacatgggtgctgaggatgtccgccgtcaagccctaaatgtcttc
cggatgaagctccttggagcctcggtcgtggccgtcgatgccggaagcaggactctgcgt
gatgctgtcaacgaggcccttcgtgcctgggttgttgacctggacaccacccactacatt
atcggctccgccattggacctcaccccttccccaccatcgtgcgtaccttccagtccgtc
atcggcgaggaaaccaagcagcagatgatggaggccatcggcaaactccccgatgccgtc
gtcgcttgtgtcggcggtggcagtaatgccgtcggcatgttctaccccttcgccaaagac
actagcgtcaagctggtcggtgtcgaggccggaggcgacggtatcgacacaaacagacac
tcggcgaccctgaccggcggcagcaagggcgtgctgcacggtgttcgcacgtacgtcctc
caggacgaacacggccagatctccgagacccactccatctcggccggcctggactacccc
ggtgtcggccccgagctcagctcgtggaaggacagcgaccgcgcccgcttcatcgctgcc
accgacgccgaagccctgatcggcttccgcaccctcgcgcagaccgagggcatcatcccc
gccctggagtcctcgcacgccgtctggggcgccatggaactcgccaagtccatgaagaca
ggcgacatcgtcctgaacctgagcggccgaggagataaagacgtccagagcgtcgcggac
gaactaccccgcctgggtcccaagatcggctgggacctgcgattctaa

DBGET integrated database retrieval system