KEGG   Aspergillus fumigatus: AFUA_2G14060Help
Entry
AFUA_2G14060      CDS       T01017                                 

Definition
NADH-cytochrome b5 reductase (EC:1.7.1.1)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afm  Aspergillus fumigatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_2G14060
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AFUA_2G14060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 309 aa AA seqDB search
MSALSSENINGVYIPSALLLFGTFIVKKEFVPYAVAVTAILAGLKLFTGGNKPRKVLNPT
EFQEFVLKEKIDVSHNVCIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPIS
SDNEAGYFDLLVKAYPQGNISKYLTTLKIGDTMKVRGPKGAMVYTPNMCRHIGMIAGGTG
ITPMLQIIKAVIRNRPRNGGNDTTKLDLIFANVNPDDILLKEELDMLAAEDPDFNIYYVL
NNPPQGWTGGVGFVTPEMIKEHLPAPASDVKILLCGPPPMISAMKKATESLGYTKARPVS
KLEDQVFCF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattgtcatctgagaatatcaatggggtctacatcccgtcagccctcctcctc
ttcggcaccttcattgtgaagaaggagtttgtcccatatgcagtggctgtgaccgctatc
ctggctggactgaagctgttcacaggcggcaacaagcccagaaaagttctcaaccctacc
gagttccaggaattcgttctcaaggagaagatcgacgtctcgcacaatgtttgcatctat
cgctttgccctcccccgtcccaccgatatcctgggcttacccattggtcaacacatctcc
ctcgctgccactatcgagggtcagccgaaagaagttgtccgctcctacactcccatttct
tcggacaatgaggccggttactttgatttgctcgtaaaggcctatccccagggtaacatt
tccaagtacttgaccaccttgaagattggcgataccatgaaagtgcgcggtcccaagggt
gccatggtctacactcctaacatgtgccgtcacattggtatgattgctggtggtactggc
atcacccccatgttgcagatcatcaaggccgttattcgcaaccgccctcgcaatggcggc
aacgacaccaccaaattggacctgatcttcgccaatgtcaacccagatgacatcctcctt
aaggaggagctggatatgctggctgctgaggatccggacttcaacatctactacgttctg
aacaaccctccccaaggctggactggtggcgttggatttgttactcccgagatgatcaag
gaacatctccctgcgcctgccagcgacgttaagattctgctctgcggcccccctcctatg
atcagtgcgatgaagaaggctaccgagtcgctcggttacaccaaggctcgccccgtcagc
aagcttgaggaccaggtcttctgcttttag

DBGET integrated database retrieval system