KEGG   Aspergillus fumigatus: AFUA_2G14130Help
Entry
AFUA_2G14130      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1694 aa AA seqDB search
MGGFDGQHSESVNGQHNRITTVMNQSSSVSSIVIPLVLCHLKNAIEEARDSRRSRLFFIS
WFNLTLSSNHQLLACLFKSTIIVLPRAATRRAQLTVTTSSTKRRKVAEPRRPGGALPGLS
FASQAGRRHSLHPPSDSSSLPPNPRPSSTSGSNRSRSPSVSPSPRYIPAHLQEEVLGTAA
RSPTPESASSAADYPSIACAGLTLHSDTMTDMSGSDKKDGSVPPTGGDVRSSSPGIKRSA
PNADQDVDMDLGSTEKRSVSLTHHTDAMDITTAEGNSNGSSDNSGSDNVYPTPSSMSTFT
ASTATRRESKAQASISSHDLPPIDDQVAQVTCTMAQPLKEKQKGYLVSMSWLKRVLSRSS
THADKADKSAAEGEIGPVDNSDLVLVTDPAITGFHDEAGEPFVPLRPGLQMGEDFEIVPQ
EGWDLIMRWYGLASQSPAIVRYAHNTVEEGDAQNIQYELYPPIFTVLKLANPAAGTTPQS
LREKNMPPAKVLSSRHTNFQKWLKQVKGLANVDMSTKVRVWRILGGLGSATASAAITPAA
SRSASPAPTASLVANAGNNLVLDLNTFLSLSDGAQRELVDNVKDQTNNPNFNGRSTLDRV
GLSTSDVVVLEERVGGEWASEVSKKTLDRLGVPSGSVKNGAPAKLKNKSPNNSGRSSPAP
EPIRGRRKDGKPRGCTGLSNLGNTCYMNSALQCVRSVEELTYYFLNDVYKKDLNPSNPLA
HNGDIAKAYANLLRMLYDEAGQSSFAPRQFKHTIGRYGPAFSGYGQQDSQEFLLFLLDGL
QEDLNRIQKKPYIEKPDSTDDMVHDKVALKEFASKCWDIYKARNDSVITDLFAGMYKSTL
VCPVCEKVSIIFDPFNNLTLQLPIENLWSKEIFFFPLHRKPVIVDVEIDKNASIKALKEL
VAKKMGSDPQRLVMAEIYKCKFYKMFDNSASIADCQIGQGDDIAIFEVESVPTNYNPDKR
QKSYFSYGRSDYEEIPSFDSPKADRMLVPIFNRHYRPKSNNSGNMQRSLFGAPLYVIISR
EEALSYDAILRKVLEAVATLTTRDILNEANIKNADEQGGTQEDSDTVVMNEDDAHSADSK
IKTSSVDGEDGLVDVSMRDASDETDTPSPQDAKCDNAVSSPGSSIAPGLRSLFDMKILKS
SHEVVPLGWSSVDDIKDYPLMLARVKAQSASKQEVSSRTVHSSKKPSRLTTVQNSQTKSG
TVTDRKTSDDSDQDGSAGSASDSDSDMFSNISRPKAVKIQSGERPLIRPGEGIVLDWNDQ
AHDALFGGDKKDTDGLRGTPTWTNVERIPDPELAKRRDLRRSRKKRGVTLYECLDEFNKE
EILSENDAWYCPRCKEHRRASKKFELWKTPDILVMHLKRFSASRGFRDKLDVLVDFPVEG
LDMSGRVESPEEGKSLIYDLFAVDNHYGGLGGGHYTAYAKNFMSGQWNEYNDSSVSRPID
PQSVVTPAAYLLFYRRRSDRPLGGKILEEITESSTRPASEDNSPAASRMQSPSGNGLRLG
GSSRNGSSSALAGVGAVHQAGDGGLRTGIRARNEDSDDDESPPDYSDSPAAGEQSLAKAN
RLEGMSFDEDEFGDGAYANPLSYSSQPTWSFDRVTDAHGLSQMTTVPPGSISDDEDLFDD
DASNKAVGGGDLSDSDLRLAALTGSPIGQGVFPGTPMEEEAPIQDIPPPLDDDDDEDLPV
VELRVNDDDQIVSD
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atgggtggttttgatggtcaacactccgagtcagtcaatggccaacacaatagaattacc
acagtcatgaatcaatcttcatctgtttcttctattgttattcctcttgttctgtgtcat
ttgaagaacgcaatagaggaagccagagactcaagacgatcacgactcttttttataagc
tggtttaatcttacattatcatcaaatcatcagctactggcctgccttttcaagtcgacc
attatcgtgttacccagagctgccacgagacgtgcgcagctcactgtcacgacgtcttcc
acaaagcgccgtaaggttgcagagcctcgcagaccaggaggagcccttccgggtttgtcg
tttgcctcgcaggctggaagacgtcacagtctgcaccccccttccgactcgtcttccctg
ccaccaaaccctcgaccatcgtctacgtccgggtcgaaccgaagtcgaagcccttctgtg
tccccgtctcctcgctacattcccgcccatttgcaggaagaagtgcttggcaccgccgcc
cgctccccgaccccggaatccgccagtagtgccgccgactatccttcgatcgcctgcgca
ggactcaccctacacagcgacaccatgacggatatgtctggttccgacaaaaaggatggc
agcgttccgcctactggaggtgacgttcggtcatcctcccccggtattaaacggtcggct
cctaacgccgaccaggatgtggatatggatctaggttcgacggagaagagatctgtttct
ctaacccatcacacagacgcgatggatataaccacagcggagggaaactcgaacggcagc
agtgacaactctgggtcagacaatgtctatcccacaccatccagcatgtcgacctttacc
gcttccacggcgacccgaagggaatccaaggcccaggcctccatctcgtctcatgatctc
cctcctatcgacgaccaagtcgctcaggtgacctgcaccatggctcagccgttgaaggag
aaacagaagggatatctggtatccatgtcttggctaaagcgggtgctctctcgcagctcg
acccacgccgacaaggcagataagtcggcagctgaaggagaaattggacccgtggataac
tccgaccttgtgctggtcacagacccagcgatcaccggcttccacgatgaggccggagag
ccctttgtgcccctgcgtccaggtctgcagatgggagaggactttgagatagtgccccag
gaaggctgggatttgatcatgcgatggtacggcttggctagtcaatcgccagccattgtt
cgctatgctcacaacaccgtggaggaaggtgatgctcaaaatattcagtacgagctctat
ccaccaatcttcaccgttctgaagctagcaaacccggccgccgggaccactccacagagt
ctaagagagaagaatatgccgcctgcaaaggttttgtccagccgacacaccaacttccaa
aagtggctgaagcaagtgaaggggctggccaatgttgacatgtctaccaaagttcgtgta
tggagaatcctaggaggactgggaagcgccacggcatcggctgcaatcacccccgctgcg
tcacggagcgcttctccggcccctacggcctccctggttgccaatgctggtaacaatctt
gtgcttgacctcaatacgttcctctcattatcggacggcgctcaacgagaactggtcgat
aatgtcaaggatcaaactaataatcccaatttcaacggtcgatctaccttggatcgagtt
ggtttgtctaccagtgatgttgtggtgcttgaggagcgcgttggtggagagtgggcttca
gaagtatccaagaagacgctcgatcgactaggtgttccgagtggcagtgtgaagaatggc
gctcctgccaagctcaagaacaagagtcctaacaacagtggtagatcatctcccgcgcca
gaacctattaggggccggcgtaaagatggaaagcccaggggctgcacgggattgagcaac
ctcggaaatacctgctacatgaactctgctctacagtgtgtgcgcagtgtggaggaactc
acatactacttcctgaacgatgtgtataagaaagatctcaaccccagtaatcctctcgcc
cataatggtgatatagccaaggcgtacgcaaaccttcttcgcatgctctacgacgaagcg
ggtcagtcgtcgttcgctccccgccaatttaaacacaccattggtcgttatggtccagca
ttctcgggatacggtcaacaggattcgcaggaatttctgttgttcctgcttgatgggctg
caagaagatttgaacagaatccagaagaagccatatatcgagaagccagactccacagac
gatatggtccatgataaggtggccctcaaagagtttgccagtaaatgctgggacatttac
aaagcccgcaatgactcggtcatcacggatctctttgctggcatgtacaagtcaactctt
gtctgtcctgtctgcgagaaggttagcatcatcttcgatccattcaacaacttgacactc
cagcttcccatcgaaaatctttggagcaaggagatcttcttttttcctctccaccgcaag
cctgtcatcgttgacgtggaaattgataaaaacgccagcatcaaggcgctcaaggagtta
gtagccaagaagatgggctcggatccccagcgtctcgtcatggccgaaatctacaagtgc
aagttctataagatgtttgacaactctgcgtccattgctgattgccagatcggccaaggc
gatgacatcgcaatcttcgaggtcgagtctgttcccacgaactataatcccgacaagcgc
cagaagagttacttttcttatggccgttcagactatgaagaaattccaagctttgattca
cccaaggcagaccgaatgctagtgcccatcttcaatcggcattaccggccaaagtcgaat
aacagcgggaatatgcagcggtcactcttcggcgctcctttgtatgtaatcatcagcaga
gaagaggctctaagttacgatgccatcctccgcaaagttcttgaagctgttgccacgtta
acaacacgagacattctcaatgaggcgaacatcaagaatgctgacgagcaagggggaact
caagaggattcggataccgttgtgatgaatgaagacgatgcgcattctgcggattctaaa
atcaagacctcatccgtggacggtgaggatggcttggtggacgtttccatgcgcgacgct
tctgacgagacggatactccatctcctcaagacgccaagtgtgacaatgctgtctcgagc
cctggcagctctattgcacctggccttcggagcctcttcgacatgaagattcttaaatcg
tcccacgaagttgtacctctcggctggtcttcagtggacgatatcaaggactatccattg
atgttggccagggtcaaggcacagtcggctagcaaacaggaggtaagcagccgcacagta
cattcatcaaagaagccaagcagactgacaacggtgcaaaattcacagacaaaatccggt
acagtgaccgaccgaaaaacaagcgatgactcggatcaggatggaagtgctggcagtgct
tctgacagtgactctgacatgttctccaacattagtcgccctaaggctgtgaaaattcag
agcggcgagcgtcctctgattcgcccgggtgaaggtatcgtgctagattggaacgatcaa
gcccacgatgccctatttggtggggataagaaggacactgacgggctacgtggaactcct
acgtggactaacgtggagcgcattcctgatccggaactcgccaaacgccgtgatcttcgt
cggagccggaagaagaggggcgttacactctacgaatgtcttgacgagttcaacaaagag
gaaattctttccgagaatgatgcatggtactgcccccgctgcaaggagcatcgcagagcc
agcaagaagttcgaattgtggaaaactcccgacatccttgtcatgcacctgaagagattc
agcgccagcaggggtttcagggacaagctggatgtgctggtcgacttccccgttgaaggg
ctagacatgagcggccgtgtggaatcgccggaagaaggaaagagcctaatctatgatctt
ttcgcggttgataaccactacggtggattaggaggcggtcactatacggcctacgcaaag
aactttatgagtggccaatggaacgagtacaatgattcgtctgtctcacgaccaattgat
ccccagagcgtggtgactcccgccgcgtatctattgttttaccgtcgacgttcagatcgt
ccgttaggcggaaagatcttggaagaaatcaccgagtcgtcaactcgaccagccagtgag
gacaactccccggctgcgtcccgcatgcagtcgccttcggggaacgggctgcgtctcggc
ggctcctcccgcaatgggtcgtcgagcgccttagccggagtcggagcagttcaccaagcg
ggagatggtggtttgcgaactggaatccgggcgaggaatgaggacagtgatgatgatgaa
tccccccctgactattcggacagcccagccgctggcgagcagagcctcgcgaaagcaaac
cgactggaaggtatgagctttgatgaagacgagttcggcgatggagcctatgccaacccg
ctctcctactcaagccaacccacgtggtccttcgaccgagtcacagatgctcatggcctt
tcacagatgaccacagtgcctccgggatcgatctctgatgacgaggatttgtttgacgac
gatgccagcaataaagcggtgggcggcggagatctcagcgactccgacttgcgcctcgcc
gcattgaccggtagtccaatcggtcagggggtgttcccaggcacgcccatggaggaggaa
gctccgattcaggacatccctccaccactagacgatgacgacgatgaagatttacccgtg
gtagagctacgggtgaatgatgatgaccagatcgtctcggactga

DBGET integrated database retrieval system