KEGG   Aspergillus fumigatus: AFUA_3G00320Help
Entry
AFUA_3G00320      CDS       T01017                                 

Definition
endo-1,4-beta-xylanase (XlnA) (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AFUA_3G00320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 228 aa AA seqDB search
MVSFSYLLLACSAIGALAAPVEPETTSFNETALHEFAERAGTPSSTGWNNGYYYSFWTDG
GGDVTYTNGAGGSYSVNWRNVGNFVGGKGWNPGSARTINYGGSFNPSGNGYLAVYGWTTN
PLIEYYVVESYGTYNPGSGGTFRGTVNTDGGTYNIYTAVRYNAPSIEGTKTFTQYWSVRT
SKRTGGTVTMANHFNAWSRLGMNLGTHNYQIVATEGYQSSGSASITVY
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggtttctttctcctacctgctgctggcgtgctccgccattggagctctggctgccccc
gtcgaacccgagaccacctcgttcaatgagactgctcttcatgagttcgctgagcgcgcc
ggcaccccaagctccaccggctggaacaacggctactactactccttctggactgatggc
ggcggcgacgtgacctacaccaatggcgccggtggctcgtactccgtcaactggaggaac
gtgggcaactttgtcggtggaaagggctggaaccctggaagcgctagaaccatcaactac
ggaggcagcttcaaccccagcggcaatggctacctggctgtctacggctggaccaccaac
cccttgattgagtactacgttgttgagtcgtatggtacatacaaccccggcagcggcggt
accttcaggggcactgtcaacaccgacggtggcacttacaacatctacacggccgttcgc
tacaatgctccctccatcgaaggcaccaagaccttcacccagtactggtctgtgcgcacc
tccaagcgtaccggcggcactgtcaccatggccaaccacttcaacgcctggagcagactg
ggcatgaacctgggaactcacaactaccagattgtcgccactgagggttaccagagcagc
ggatctgcttccatcactgtctactag

DBGET integrated database retrieval system